KEGG   Pocillopora damicornis (lace coral): 113675387Help
Entry
113675387         CDS       T05773                                 

Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase-like
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00760  Nicotinate and nicotinamide metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    113675387
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pdam04090]
    113675387
   00536 Glycosaminoglycan binding proteins [BR:pdam00536]
    113675387
Enzymes [BR:pdam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     113675387
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     113675387
CD molecules [BR:pdam04090]
 Proteins
  113675387
Glycosaminoglycan binding proteins [BR:pdam00536]
 Hyaluronan
  Cell surface receptors
   113675387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 113675387
NCBI-ProteinID: XP_027047757
Position
Unknown
AA seq 285 aa AA seqDB search
MALKFVLWMLVILASLHSISSHGSARHLKEIVLGRCWDFQRQKTSEVTPKNCSKLWETFH
NAFAFKDPCATNFSDYEPFFDEVGMDIVKRDKSLFWSGTYKEAHEYSDFNSRLTTLEDTM
AGWMMNGLTWCGSKNKSSDGINYDSCPNCSHFKAFWGLASRRFAEKASGISHVLVNGSRL
INGTPAAYSRTNFFGSMELPNLNKSNVIELKILVVHNIGGPVLEVCGNGSIKEMEEDANK
RGIKTTCLDDPSQIQHLLCADFPESRVCRFLRSATRSVTKSVSCG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggccttgaaatttgttttatggatgctagtgattttagcttcgttacattcaatatca
tcgcatggttcggcgaggcatttaaaggaaattgtcctcggtagatgctgggactttcaa
cggcaaaagacgtccgaggtcacccccaagaactgttcgaaattatgggaaacatttcac
aatgcattcgccttcaaggacccgtgtgcaacgaatttctctgattatgaacctttcttt
gatgaagttggaatggacattgttaaaagggataagagtctcttttggtcaggaacatac
aaagaagctcacgaatactcggactttaactccagactgactacattagaagatacaatg
gcaggatggatgatgaatggcttaacttggtgtggttcaaaaaataaatcatctgatggt
attaactacgattcctgtccaaattgcagtcacttcaaagcattttggggcttagcttca
agaagatttgcagagaaagccagtggaatctctcatgtcttggtcaacggatcgcggtta
ataaacgggacaccagctgcttactcaagaacgaatttctttggaagtatggagcttcca
aaccttaacaaaagcaatgtcattgagctgaaaattttagtggtccataacatcggtggt
cccgttttggaggtttgtggcaatggctcgatcaaagagatggaggaggatgctaacaaa
agaggcataaaaacgacttgcctcgatgacccgtcgcaaattcaacatctgctgtgcgct
gatttcccagaatctcgcgtgtgccggttccttcgtagtgcaacaaggagtgtaacaaag
tccgtgagttgtgggtga

DBGET integrated database retrieval system