KEGG   Pocillopora damicornis (lace coral): 113676104Help
Entry
113676104         CDS       T05773                                 

Definition
(RefSeq) glutathione hydrolase 1 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00430  Taurine and hypotaurine metabolism
pdam00480  Glutathione metabolism
pdam00590  Arachidonic acid metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113676104
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    113676104
   00480 Glutathione metabolism
    113676104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113676104
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pdam04090]
    113676104
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     113676104
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     113676104
    3.4.19.14  leukotriene-C4 hydrolase
     113676104
Peptidases and inhibitors [BR:pdam01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   113676104
CD molecules [BR:pdam04090]
 Proteins
  113676104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept Pim DUF4932
Motif
Other DBs
NCBI-GeneID: 113676104
NCBI-ProteinID: XP_027048525
Position
Unknown
AA seq 610 aa AA seqDB search
MEEGKYKEPFSGNLTEKRRRLNGIICITITVAFLLLFIIIFPIVWTTYKEEPIPTRSVGI
PPPPTGPPGADGPYKHAVVASDAGLCSEIGRDVLKKNGSAMDASIAALFCIGVYNMHSAG
IGGGGFLVVYNKSNKFVEVIDFREEAPGKANRNMYVNETMSSKLGPTASGVPGEVKGFYE
GWKKYGKLPWRELVQPSIDMAKKGFPFGYAAYKAAARSTVKPLLKKDPGLRELLFNKKGE
LKQLGETLYMPKYAKTLEKIRDKPDDFYNGKLAEDIAKDIKEGGGIFTLEDLKKYKAKFK
TPIQGTLGKYNWYSTPPPGSGAVLSLILNILKGYNMKPSDRNGTKNSVLTYHRIVEAFKF
AYAYRALLGDQDFANVTQVLKQMTNETFAESLRQRIRDDRTFTNYTHYGDFYQKSNDQGT
SHLSVIAENGDAVSATTTINLYYGSKYRSTRTGIIYNNEMDDFSTPGRENAFGVLPSESN
MIVPGKRPQSSTTPSIFVDKSGVARLVLGASGGTKITTAVSLVTMNYLWFGRTLPQAVVD
PRLHHQLQPMYIRIDEDYPMPLLIQEGLKNLGHKVEAKSLYAVVQAVARNEDGTLTGKSD
PRKSSWAAGY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggtaaatataaagaaccgttttcaggtaacctgacagagaaacgtagacga
ctcaacggcatcatttgcattacgataaccgttgcattcttgctgctatttataattata
ttcccgattgtctggacgacttacaaagaggaaccaatccccaccaggagcgtggggatt
cctcctccaccaactggtccaccaggagcggatggcccctataaacacgcggttgttgcg
tcagacgctggcctatgctcagagataggccgtgacgttctgaagaaaaatggatcagcc
atggatgcttccatcgccgccttgttctgtattggggtttacaacatgcattcggccggt
atcgggggaggcggcttcctggttgtgtacaacaagagcaataaatttgtggaggtcata
gactttcgcgaagaagccccagggaaggccaacagaaacatgtatgttaatgagacgatg
agctccaaattaggtcccacagcatctggggtgccgggcgaggtgaaaggtttttacgaa
ggctggaaaaagtatggcaaacttccctggagggaactggtgcagccttccattgacatg
gccaaaaaaggatttccatttggttatgctgcttacaaggcggccgcaaggtcaactgtc
aagcctcttcttaaaaaagatcccggcttgagggaacttctcttcaacaagaaaggcgaa
ttaaagcagctaggcgagaccctgtacatgcccaagtatgcgaaaacactggagaaaatt
cgtgacaaacctgatgatttttacaacggaaaactggccgaggacattgcaaaggacatc
aaggaaggcggcggtatttttaccttggaagatttaaagaaatacaaggcaaaattcaag
acacccatacaaggaactctggggaagtacaactggtactcgacccctccccccggaagt
ggtgcggtgctgagtcttatcctgaatattttaaaaggatacaacatgaagccatcagat
cggaatggaacaaagaattcggtcttgacgtaccacaggattgtagaggcttttaagttt
gcgtacgcgtacagagctttgttgggagaccaggactttgcaaatgtaacacaggttctc
aagcaaatgacaaacgagacgtttgcagaatctctacgtcagaggattcgggacgaccgc
acattcacaaattacacacactacggtgacttctatcaaaaatccaacgatcaggggact
tcacacttgtctgttattgcagaaaatggcgacgctgtttcagcaactacaacgatcaat
ctgtactatggatcgaaatatcgatcgactcgtactggaatcatttacaacaacgaaatg
gacgacttttcgactccagggagagaaaacgcgttcggtgttttaccatcagaatcaaat
atgatcgtaccagggaaaagacctcaatcctccaccacaccctctatatttgtggataaa
agcggagtggcacgtttggttcttggtgcgtctggtggaacgaaaataacaactgcagtt
tccctggttacaatgaattatctctggtttggccgaaccctccctcaagccgttgtcgat
cccaggctccaccatcagttacaaccgatgtatattcgtatcgacgaagattaccccatg
cctctgctgatccaagaaggattaaagaatcttgggcataaagtagaggccaagagcctt
tacgcagtggtccaggctgtggcaaggaacgaagatgggacattgactggcaaatcggac
ccaaggaagagtagctgggcggctggatactga

DBGET integrated database retrieval system