KEGG   Pocillopora damicornis (lace coral): 113676163Help
Entry
113676163         CDS       T05773                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4-like isoform X1
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113676163
Enzymes [BR:pdam01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     113676163
Chaperones and folding catalysts [BR:pdam03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    113676163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 113676163
NCBI-ProteinID: XP_027048582
Position
Unknown
AA seq 136 aa AA seqDB search
MPPKKGKGGGGGKQDKGKGGKGGGGGEDEGASGGKAKKGGTAVKVRHILCEKHSKAMEAM
AKLKDGQKFNEVASAYSEDKARQGGDLGWMTRGSMVGPFQDAAFALSPSTVDKPAYTDPP
VKTKFGYHIIMIEGKK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaaaaagggaaaaggaggtggaggtggtaaacaagataaaggaaaaggagga
aaaggaggagggggtggtgaagatgagggagccagtggagggaaggcaaaaaagggtgga
actgcagtgaaggttcggcatatcttatgtgaaaaacactctaaagcaatggaagccatg
gcaaagttaaaggatggtcaaaagtttaatgaagtcgcctcagcatacagtgaagataaa
gcaagacaggggggtgatttaggatggatgacaaggggatcgatggttggtccatttcaa
gatgcagcctttgccctctcaccaagcacagttgataaaccagcatatacagatccccca
gtcaagacaaagtttggttatcatattattatgatcgaaggaaagaaataa

DBGET integrated database retrieval system