KEGG   Pocillopora damicornis (lace coral): 113676286
Entry
113676286         CDS       T05773                                 

Definition
(RefSeq) patatin-like phospholipase domain-containing protein 4 isoform X1
  KO
K11157  patatin-like phospholipase domain-containing protein 4 [EC:3.1.1.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113676286
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     113676286
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 113676286
NCBI-ProteinID: XP_027048735
Position
Unknown
AA seq 267 aa
MNLSFAGCGFLGVYHLGVATCLTSHAPQFLKNVTAFAGASAGSLVAAVLATSAPLDKCSD
YVIELTHDARRHPLGPFNPQFDLVGSLRKGLELYLPSNSHRIASGRLFISVTSLKDRKNA
ILSEFDSKEDLIQVLLASCYIPFYAGLSFPRFRGQKWVDGGLSDNLPRLPFGRTIRVSPF
SGNGNDICPQDESRGFTDVTFHNMNVYVNRENLQRELQIFIPPKKDGIESLVQLGFNDTL
RFLRKENLCNYSVKPLSPTLPMKHFHE
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaacctgtcatttgcaggctgtggttttcttggggtttaccaccttggagttgcaact
tgcctaacatcgcatgctccacagtttttaaagaatgtaacagcctttgcaggtgcttca
gcagggtcacttgttgctgcagtgctagcaacatcagctccactggacaagtgttcagat
tatgtcatagaacttactcatgacgctcgtagacaccctctggggccttttaatccccag
tttgacttggttgggagtttaagaaaaggacttgaactttatcttccttcaaattcccac
cgaattgcttcaggaaggctttttatttctgtgaccagtctaaaggacagaaagaatgca
attctgtctgagtttgattccaaagaagacttaattcaggttttgctggcaagttgttat
attcccttctatgctggactgagctttcccagattcagaggtcagaaatgggtagacggt
ggacttagtgataatttaccaaggcttccgttcggccgaactatacgtgtatctccattc
agtggtaatggtaatgatatatgcccacaagacgagtctcgtggttttactgacgtcact
ttccataatatgaatgtctacgtaaatagagagaatcttcagagagagttgcagatattt
attcctcccaagaaagatgggattgagagtttagtgcagttaggttttaatgacactctg
agatttctgcgaaaggagaacttgtgcaattattcagtgaaacctctttctccaactctt
cccatgaaacattttcatgaatag

DBGET integrated database retrieval system