KEGG   Pocillopora damicornis (lace coral): 113676513
Entry
113676513         CDS       T05773                                 

Definition
(RefSeq) all-trans-retinol 13,14-reductase-like
  KO
K09516  all-trans-retinol 13,14-reductase [EC:1.3.99.23]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113676513
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.23  all-trans-retinol 13,14-reductase
     113676513
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO FAD_oxidored GMC_oxred_N FAD_binding_3 GIDA Thi4 MCRA HI0933_like Pyr_redox_2 Pyr_redox GDI Pyr_redox_3 AlaDh_PNT_C
Other DBs
NCBI-GeneID: 113676513
NCBI-ProteinID: XP_027048978
Position
Unknown
AA seq 643 aa
MALVMKFVELVSTFLQNSSGTFLFLTLLVAVLIPLVVFRIRAKLNKRGPNPFTFDCRRPP
QPLVLDQAERDKVIKQGFVARKVPDNLDAIVIGSGIGGLTSAALLAKAGKKVLVLEQHDQ
AGGCCHSFIDKGYEFDPGIHYIGEMNCTGTMRLLSDQLTEGQLDWVPLEKQYDTVVIGNG
DNARKYPICGGRQNEYRNALYESFPKERKAIDQYMKLLKDVRKSMPGYVAFKLMPVWLAK
FMFTTGISNWMTKFFKYSKRSVAEVLEELTDDKDLQTVLAYNFGDYGTLPGEGSFAMHAI
LANHYLFGAFYPRGGASEIAFHIIPVIEKAGGKVLVRARVSKILVEEASGKVQGVRVQKG
GSEMDIFAPVVISAAGIYNTFETLLRCEEPIPDKNLLKSEGVRHGYAAMSVYVGLKGTKE
DFRLKASNVWAFTDNELDKSTRKYLQSDAATAGTEDIPLLFISFPSTKDPEWDRRHPGKT
TCTVITLAPYEWFERWENERVMKRGEEYEEFKNRIGKRIWEQTCKLFPQVCDRVDFFDVG
SPLSNRYYIAAPRGEIYGIDHHIDRFSPNAAMKLRPDTSIPGLYLTGQDILSCGFAGAMF
SGVITASAVLKRNLFADMSRLQTEVKIKAAKENGVASDGLVKE
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggctcttgtgatgaagtttgtggagttggtttcaacttttctccaaaattcctctgga
acttttcttttcttaacgttacttgttgcagtccttataccgttagttgtcttcagaatc
cgtgcaaagctgaataaaagaggaccaaaccctttcacctttgactgtcgaaggccacct
caacccctggtcttagaccaggcggaacgggacaaagtgatcaagcaaggatttgttgcg
cggaaagtgcctgacaacctcgatgctatcgtgataggtagcggaattggagggcttacc
tctgcagcccttttggcgaaggcaggaaagaaggttctggtgttagagcagcatgatcaa
gcaggaggatgctgccattcgtttatagacaaaggttatgagtttgatccaggtattcat
tacattggagaaatgaactgcacagggacaatgcgtcttctctcagatcaactaactgaa
ggtcagctggattgggttccccttgaaaaacaatatgacactgtagtgattggcaatgga
gataatgcaagaaagtacccaatctgtggtggacggcagaatgaataccgcaatgcgttg
tatgagagttttccaaaagaaaggaaagctattgatcaatacatgaaactgcttaaggat
gttcgtaaatcaatgccaggttatgtagctttcaaactcatgcctgtgtggttggccaaa
ttcatgtttacaactggaatttcaaactggatgacaaagtttttcaagtattctaaaaga
tcagttgcagaagtgttggaagaactgacagatgataaggatcttcaaactgtcctggcg
tacaattttggtgactatgggactcttccaggagaaggcagttttgcaatgcatgccata
cttgcaaatcattacctatttggagcattttatcctcgtggtggggcaagcgagattgct
ttccacatcattccggttatagagaaagcgggtggaaaagttctagtcagagcaagggtc
tccaaaattcttgttgaggaagcttctgggaaagtccaaggtgtacgtgttcaaaagggc
ggtagtgagatggatatttttgctccagttgtgatttcggctgcagggatctacaacaca
tttgagacccttcttcgatgtgaggaacccatacccgacaagaacctgctaaaatccgag
ggtgttcgtcatggttacgcggccatgtcggtctacgtcggcctcaaggggacgaaagag
gacttcagactaaaagcttccaatgtatgggctttcaccgacaacgaactcgataaaagc
actaggaagtacttacagtcggacgctgctaccgccggaactgaagatattccccttttg
tttatctcctttccctcgactaaagaccccgagtgggacaggagacaccccggtaaaacg
acatgtaccgtcatcactcttgccccgtacgagtggtttgagcgttgggagaacgaacgg
gttatgaagcggggcgaggaatacgaggaattcaaaaaccgtatcggcaagcgcatctgg
gaacaaacttgcaagctcttcccgcaagtttgcgaccgggttgatttctttgatgtcggg
agtccgttgagtaacagatactacatcgctgctcctcgtggggagatatacgggattgat
catcacattgaccggttcagtcccaacgccgcgatgaaactccgcccggatacgtccatt
cctgggttatacctgaccggacaggatatcttaagctgtgggttcgctggagcgatgttc
agcggggtgattactgcttcagctgtccttaagagaaatttattcgcggatatgagtcgt
cttcaaacggaggtgaagataaaagcagcgaaggaaaacggagtggccagtgatggttta
gtcaaagagtga

DBGET integrated database retrieval system