KEGG   Pocillopora damicornis (lace coral): 113676699Help
Entry
113676699         CDS       T05773                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00564  Glycerophospholipid metabolism
pdam00565  Ether lipid metabolism
pdam00590  Arachidonic acid metabolism
pdam00591  Linoleic acid metabolism
pdam00592  alpha-Linolenic acid metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113676699
   00565 Ether lipid metabolism
    113676699
   00590 Arachidonic acid metabolism
    113676699
   00591 Linoleic acid metabolism
    113676699
   00592 alpha-Linolenic acid metabolism
    113676699
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     113676699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 113676699
NCBI-ProteinID: XP_027049187
Position
Unknown
AA seq 747 aa AA seqDB search
MILKNEIQGNKVQETAALVQSLQASPRSCIAVKIDVLRARNVTQGWYDWIDTPDPYLMMR
IPSSAEIVKRTKCVSNNKNPEWKDEPFVFHIDPEENNVLELTLWDEDYNADDQIGSAVCL
PLNSLQLRKPERRTLKFGEYSEVDIILEASTVSGEYADLRYSSELCDEEKEFREKRKAIV
FEAMKRLLGEQGPQNMDEVPTIAVLGSGGGFRATTGFSAACRALDEMDLLDSITYLTGLS
GSAWGLSLLYSQTAGEKIDSMETQKNVREQLQWGPMWLLTPRRVMQYVRDITEKWKKGQP
VSLTDFYGHCVGESLLGPKKNSVKLSDQQGKVANGAVPMPIYTALNSKRDVSAQSYAEWV
EFTPYEIGMDKYGTFMKTELFGSKFFCGKLIEKFPESPLYYLQGIWGSFYAILLQRVLNQ
EKQINTEQDNEKHLLERQFLSEKNNKNDDDDDDSDDDVDKGVGDVGGKRNKIDVGSSLIA
KLQKDVEADEELHKLEGKATKNQKKEKKEFRRKVIDYVLEKLPGLQTRSKRAGLVHNFLR
GLGLNGAKEYTDGAATQCLFGKDNLKRKRMELIDAGLMFNSPYPPLLRKQRSVDLILSFD
FSARESDEERPFKNIKLAEDWAKRNGLLFPPIDADEQFDRDGWKECYVFKDPTNPECPII
LHFVLVNKTYRDFVRPGVPRTTKEEQKAGDFPIFNDPNKRFSTFNLKYSHDIFDRLSGLV
EFNTAINEQLIKDAMVECVQRKQTLIQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgattctcaagaatgaaatacagggtaataaagtgcaagaaactgcagcgttagttcaa
agtttgcaggcctctccaagatcatgtatagcagtgaaaatcgatgttttaagagccaga
aacgtaactcaaggatggtacgactggatcgatacaccagatccgtatttgatgatgaga
atcccttcgtcagctgaaattgtcaaaagaacaaaatgcgtttcaaacaacaagaacccc
gagtggaaagacgaaccatttgtctttcatattgatcctgaagaaaacaatgttctagag
cttaccttatgggatgaagattacaatgctgatgatcaaataggtagtgcagtctgcttg
ccgcttaatagtttacagctgagaaaaccggagcgaagaactctaaaatttggagagtat
tctgaagtggacattatcctggaggcatccacagtatctggagagtatgctgatcttcgt
tacagttcagaactttgcgatgaagagaaagaattcagagaaaagagaaaagctatcgta
tttgaggccatgaaaagattgttgggagaacaagggccacaaaacatggatgaggttcct
acaatagccgtccttggctcagggggtggtttccgagccacgacaggcttcagcgcggct
tgtcgcgcccttgatgaaatggatcttttagattccatcacttatttaaccggtttatcc
ggttcagcttggggtttatcgttgttatactctcaaacagcgggagagaaaattgactcc
atggagacccagaagaatgtcagagaacaactacagtggggacccatgtggttacttact
ccccggagggtgatgcaatatgtaagagatatcaccgaaaaatggaagaaaggacagcct
gttagtctgacagacttttatggccattgtgtcggagaaagccttttaggacctaaaaag
aactctgtaaaactaagtgatcaacaagggaaggttgcaaatggagctgttcccatgcca
atatacactgctcttaactccaaaagagatgtatcagcacagtcatatgcagaatgggtg
gagtttaccccttacgagattggaatggacaagtatggcacctttatgaagacagaactt
tttggaagtaaattcttttgtgggaaactcatcgagaagttccctgaatctccactttat
tatttgcaaggaatctggggaagtttttacgcaatcctgctgcagagagttctgaaccaa
gaaaagcagataaatacggaacaagataacgagaaacatctattagagcgacagtttctt
tctgaaaagaacaacaaaaacgatgatgatgatgacgatagtgatgatgatgtcgataaa
ggcgtcggtgacgttggcgggaaaagaaacaaaattgatgttggaagttctctgattgcc
aaactacaaaaagacgttgaagcagatgaagaactccacaagttggaaggcaaagcgaca
aaaaaccagaaaaaggagaagaaagagttccgtagaaaagtgatagattatgtacttgag
aagttaccaggtctccaaactcggtcaaaaagagcagggctggtccataactttcttcga
ggcctggggcttaatggagctaaagagtacacagacggagcagcaacacagtgtctcttt
ggaaaagataacttgaagagaaaacgaatggaactcatcgatgcaggactgatgtttaat
tcaccctacccaccccttctgaggaaacagaggtccgttgatcttattctgtcatttgat
ttcagcgccagagagtctgacgaggaaaggccatttaagaatatcaaattagcggaagac
tgggctaaacgaaacgggcttcttttcccgccaattgacgcagacgaacagtttgacaga
gacggatggaaggaatgttacgtgttcaaagatcctacaaaccccgagtgtccaattata
cttcactttgtccttgtaaacaagacttacagagactttgtgagaccaggagtccctcga
actactaaggaggaacagaaagctggtgattttccaatattcaacgatcccaacaaacgg
ttcagtacctttaacttaaagtattcgcacgacatctttgatcggctcagtggcttagtt
gagtttaacacggcaatcaacgaacagcttataaaggatgccatggtggaatgtgtgcag
agaaaacaaacactcatccagtga

DBGET integrated database retrieval system