KEGG   Pocillopora damicornis (lace coral): 113677055Help
Entry
113677055         CDS       T05773                                 

Definition
(RefSeq) dihydropteridine reductase-like
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00790  Folate biosynthesis
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    113677055
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     113677055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase
Motif
Other DBs
NCBI-GeneID: 113677055
NCBI-ProteinID: XP_027049603
Position
Unknown
AA seq 240 aa AA seqDB search
MAVARVLVYGGKGALGATCVTYFKSKDWWVASVDLFPNEEAHANVVVTKTDSWTEQNEEI
QPKVEEILDGNKFDAIICVAGGWAGGSAKSKAVVKNADLMFKQSVWTSLISASIASKHLK
ENGMLTLTGAQPSLGATPGMLGYGMAKAAVHQLVKGLADEKGGLPSNASVLAILPMTLDT
PGNRKGMPNADFNQWTPLEYVANLLFEWTQDSDVPPRGSLVKLKTQDGISSYEIHTGGLL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagcaagggttttggtttatggcgggaaaggagcccttggagctacctgtgtg
acttatttcaaatccaaagattggtgggtggcttctgttgacttgtttcctaatgaagaa
gcacatgcaaatgtggttgttaccaagacagactcatggactgagcaaaatgaagagatt
cagcccaaggttgaggagatccttgatggtaacaagtttgatgcaataatctgtgttgca
ggaggctgggctggtggcagtgccaaaagcaaagctgttgtcaagaatgcagacttaatg
ttcaagcagagtgtttggacctctcttatttctgccagtatcgcttctaagcatttgaaa
gaaaatggtatgttgacgttgactggagctcagccttctctgggggctacaccaggaatg
ttgggttatggtatggccaaggctgctgtgcaccaacttgtcaaaggacttgctgatgag
aaaggaggtctgccaagcaatgcttctgttctggctatcttgcccatgacattagacaca
cctggtaacaggaagggaatgcctaatgctgacttcaatcaatggacaccccttgaatat
gttgcaaacttgttatttgaatggactcaagatagtgatgttccaccgaggggaagtttg
gtcaaactaaaaacccaagatggaatctcttcttatgaaattcacaccggcggacttctt
tga

DBGET integrated database retrieval system