KEGG   Pocillopora damicornis (lace coral): 113677553Help
Entry
113677553         CDS       T05773                                 

Definition
(RefSeq) maleylacetoacetate isomerase-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00350  Tyrosine metabolism
pdam01100  Metabolic pathways
Module
pdam_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113677553
Enzymes [BR:pdam01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     113677553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 113677553
NCBI-ProteinID: XP_027050171
Position
Unknown
AA seq 218 aa AA seqDB search
MVDMAKPVLYSYFRSSCSWRVRTALAIKEIDYDTHAVHLLKDGGQQFSDEFKKLNPMGYV
PALVIDGHTLADSLSIIEYLDETRPDPPLLPRGDPFKKALVRQVSQTIASGIQPIQNLSV
LKYLGDERKAEWGHHWINKGFHNLEKILERTSGKYCVGDEISMADLCLVPQVYNANRFKV
DMSQFPVISRINDDLSKLEAFKVSHPSKQPDCPEESRE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatggcaaaaccagtgttgtattcttatttccgaagttcttgctcgtggaga
gttaggactgctcttgccataaaagaaattgattatgacacacatgctgttcacctgctg
aaagatggaggccagcaattttcagatgagtttaaaaagttaaatcccatgggctatgtt
cctgctctggttatagatggacacacccttgctgactcactgagcataatagagtatctg
gatgaaacaagacctgatccccccctgctacccagaggtgacccattcaagaaagcactg
gtgaggcaagtgagccaaactatagccagtggaatacaaccaatccagaatctttctgtc
ctgaagtatcttggcgacgagagaaaagcagagtggggacatcattggataaacaaagga
tttcataatctggagaaaatcttggaaaggacatcagggaagtattgtgttggagatgag
atatcaatggctgacttatgcctggttcctcaggtgtacaatgcaaacaggtttaaagtt
gacatgtcccagtttccagtcatatcaagaattaatgatgatctctccaagttagaggct
ttcaaagtgtcccacccttctaaacaacctgactgtccagaagaatcgagggagtaa

DBGET integrated database retrieval system