KEGG   Pocillopora damicornis (lace coral): 113678235Help
Entry
113678235         CDS       T05773                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00340  Histidine metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    113678235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113678235
Enzymes [BR:pdam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     113678235
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113678235
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 113678235
NCBI-ProteinID: XP_027050914
Position
Unknown
AA seq 296 aa AA seqDB search
MASAEGQDIYLSSLKQFRKRSNVRQVVENFAEDVASHTMSNISNSCLASSVFRVLGVGSG
HGKTDLRILNSIATAIESSQKKKPVIHTAIIEPSDMIQEFKSSVTPLPQTLCSLADVSFE
WHQETFQQFIASCPREDYFDMIHFVASLYYMDAESSLKSSLKLLASGGAMFCILSSETSF
FPKLAKKLKPDCVNLGSAKKIYTQMDVRKIAQRNNWKYEELSRAHYSVDISCCFDESSTE
GGLLLDFLTHQENFRVNAESAVYREAMEFLSEECKVDGNGAKFIQPEFAAVVIYKQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagccgaaggacaagatatctatctctcgtcactcaaacaattccgaaaaaga
tccaatgtaagacaagtagttgagaattttgcggaagatgttgcatctcatacaatgagt
aatatctccaatagctgcctcgcgtcttccgtttttcgtgttcttggtgttggcagtgga
catgggaaaactgatctgagaattctgaattcaatagcaacagctatcgaatcttcacaa
aagaagaaaccagtgatacacacggctatcattgaaccgagtgatatgatacaggagttc
aagtcatcagtaacaccactgccgcagacactatgcagtttggctgatgtttcgttcgaa
tggcaccaggagacctttcagcaattcatcgcatcttgtccacgtgaagattatttcgac
atgattcatttcgttgcgtctttgtactacatggatgccgaaagctccttaaaaagctct
cttaagttgcttgctagcggtggagccatgttctgcatactttcatcagaaacatcgttt
ttcccgaagctggccaagaaactcaaaccggattgcgtcaacctgggctcggcgaagaaa
atttacacccagatggatgttaggaaaattgcccaaaggaacaactggaaatacgaagaa
ttatcaagggctcactacagtgtcgacatcagttgctgcttcgatgagtcttcgacagaa
ggtggcttacttctcgactttttaacccatcaagaaaacttccgtgttaatgctgaaagc
gcggtctacagagaggcgatggagtttttgagcgaagaatgcaaggtcgatggaaacgga
gcgaaatttattcagcccgaattcgctgccgttgtaatttacaaacaatga

DBGET integrated database retrieval system