KEGG   Pocillopora damicornis (lace coral): 113678700
Entry
113678700         CDS       T05773                                 

Definition
(RefSeq) epidermal retinol dehydrogenase 2-like
  KO
K15734  all-trans-retinol dehydrogenase (NAD+) [EC:1.1.1.105]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113678700
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     113678700
SSDB
Motif
Pfam: adh_short adh_short_C2 KR UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 113678700
NCBI-ProteinID: XP_027051403
Position
Unknown
AA seq 306 aa
MVCLLIEVFSLVGIILWHFLKSFIQIFFPPPRKDVRGEIIFLTGAGSGIGRMMALKFAKL
GATIVCVDINQMANDSTVQEIKDQGLSAYGYKCDCSSREDIYRVAELVKNDVGDVTILIN
NAGIVSGKKFLETEDWMIQKTMEVNTMAHFWTTKAFLPSMLEKNHGHVVTIASSAGLFGV
CGLCDYCASKTGAVGIDESLMMELNAMKMTGVHTTVICPFFINTGMFDGVKTRFPLLLPI
LEPNWATDKMVDAILRNQTMLLLPKILTLFLWIKCTVPTPTYHALAEFFGTNACMDDFKG
RSKKSE
NT seq 921 nt   +upstreamnt  +downstreamnt
atggtgtgccttttaatcgaagttttctctcttgtagggatcattctttggcactttcta
aagtcatttattcaaatatttttccctccacctcgtaaagacgtaagaggagagataatt
ttcctgactggcgctggtagtggaattggtcgaatgatggcgttaaaatttgccaagcta
ggagctacaattgtttgtgttgatatcaatcaaatggccaacgactctacagttcaagaa
ataaaagatcaaggactttccgcttacggttataaatgtgattgcagcagtcgggaagac
atttatcgagttgcagagcttgtgaagaacgatgtcggcgatgttacgatcttgattaac
aatgctggaattgtgagtggaaaaaagttcctggagaccgaagattggatgattcaaaag
accatggaagtcaacacgatggctcatttctggacaactaaagcctttcttccatccatg
ctggaaaaaaatcatggtcatgttgttaccattgcatcatctgctggtctgtttggtgtt
tgtggtttgtgtgactactgtgcctctaagactggtgctgttggtattgacgaatccttg
atgatggagctgaatgccatgaagatgacaggagtacacacaacagttatatgtccattc
ttcatcaacacaggaatgtttgatggagttaaaaccaggttcccattactacttccaatt
ctggaacccaactgggccacagataagatggtggatgcaatccttcgcaatcaaaccatg
ttgttacttccaaaaattctgactttgtttctctggattaaatgcactgtaccaacacct
acttatcatgcactggcagagttctttgggaccaatgcttgcatggatgatttcaaagga
agatcaaagaaatcagaatga

KEGG   Pocillopora damicornis (lace coral): 113681812
Entry
113681812         CDS       T05773                                 

Definition
(RefSeq) epidermal retinol dehydrogenase 2-like
  KO
K15734  all-trans-retinol dehydrogenase (NAD+) [EC:1.1.1.105]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113681812
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     113681812
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF5455 Epimerase
Other DBs
NCBI-GeneID: 113681812
NCBI-ProteinID: XP_027054735
Position
Unknown
AA seq 341 aa
MALVYVLYALMTIQGILLALYFTGKGYVIGMIWEIACVILRVWLYVFESAMKWIFPPQRK
NIRGEIALVTGAASGIGRLIALGLAAKGCKLVIWDVNGDGLEVVAKEIEAADGVVHSYKC
NLRDRKEISKTAEKVKEEMGEVSLLINNAGIVTGKKFMDCCDEEISATIDVNILSHFWTI
KEFLPSMFQQNRGHIVSIASIAGYTGLAGAVDYCSSKFAAVGLMEALRQELLSQKKNGIQ
LTTVCPSLITTGMFDGVRFRFPNLVGFGTLTPQYAASKVIDAIEKNQIHLTMPRGAYLST
ALQHILPERATDLLLAFLGADVAMNTFTGWQKNDINDEMRS
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcgttggtatatgtgctatacgctcttatgaccattcaaggcattcttttggccctg
tatttcacgggaaaaggatatgtgataggcatgatttgggaaatagcgtgcgttatacta
cgagtttggctctatgtgttcgagtcggcgatgaaatggattttccccccacagagaaaa
aacattcgcggagaaattgctttggtgacgggagcagcgagcggaattggcagactaatt
gctcttggattggcagccaaaggttgcaaattggtgatatgggatgtcaatggtgatgga
cttgaggttgttgccaaggaaatagaagcggctgatggtgtggtgcactcttacaaatgt
aacctgcgagataggaaggaaatttccaagacagcagagaaagtgaaggaggaaatgggt
gaagtttcccttctcattaataacgctggtatcgtaacaggaaagaagttcatggattgt
tgtgatgaagaaatctcagccactatcgatgtaaacatcttatcacatttctggactatt
aaggagttccttccaagcatgtttcaacaaaaccgaggccacatagtaagcatagcatct
attgctggttatactggtcttgctggtgctgttgactactgttcatccaagtttgcagct
gttggtctgatggaggcattacgtcaagaattgttaagccagaaaaagaatggtattcaa
ctgacaacagtatgtccttcacttataaccactggaatgtttgatggagttaggttcagg
tttcctaacttggtaggctttggtactcttactccacaatatgccgcatccaaggtcatt
gatgctattgaaaagaaccaaattcacctcactatgcctcgaggtgcttatttatcaaca
gccctacaacatatcctaccagagagagctacagacctgctgttggccttccttggagca
gatgtggcaatgaacactttcacagggtggcaaaaaaatgacatcaatgatgaaatgcga
agttag

DBGET integrated database retrieval system