KEGG   Pocillopora damicornis (lace coral): 113679141Help
Entry
113679141         CDS       T05773                                 

Definition
(RefSeq) muscle M-line assembly protein unc-89-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113679141
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113679141
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pdam04812]
    113679141
   04147 Exosome [BR:pdam04147]
    113679141
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113679141
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   113679141
Membrane trafficking [BR:pdam04131]
 Others
  Actin-binding proteins
   Others
    113679141
Cytoskeleton proteins [BR:pdam04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     113679141
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113679141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Ig_6 Receptor_2B4 Ig_5 RhoGEF Izumo-Ig Ig_4 Ig_C17orf99 C1-set Spectrin Adeno_E3_CR1 SH3_2 SH3_1
Motif
Other DBs
NCBI-GeneID: 113679141
NCBI-ProteinID: XP_027051894
Position
Unknown
AA seq 10448 aa AA seqDB search
MVIIDLRGSSWKSAKPLLRTLQETVPDKVHEVYIIKPDAFWEKRRSGTGLRKEQSSVAFE
TTLLSSSSKLHQFAEGSQITQELGGTLSYNHNRWIDTRLEIEKISDESVSLNEKFDELEQ
DLDTHQLGNDIAETDGLIRQHETKRALLDNVAYPLIQRGEHLISSIKANEPPIPPSQNFT
GSPASLPSQERQQVEGNVTQLKLRCSQLMDMWEKRWKELIQCMDLLEFDAGYQKVTNWVL
GSGESYLANSNDIGDSVISCEILRKEHEEFELSAREVINHFAQVRELAKKMLQENHYASR
DIKSRKEFLDRGCRNFALRMNRRRDIILTSLKFHKSAGECSVNLDDLFELLCSDSVLMYD
YETAESMLRTLEEKAEAVAISSEDTLRDALAVQELMTSPMSNMRGDDVTQDYGKGIAHVR
LTLDELRERKLRTDELCDVRRIKLQQLLQLKQSERDAEQATVWISQLRDATEHNLGDVGR
NSEDIEALQQEHEKLETTAKSTYDYGRQFLQASLVLRRTCRYELTPNYQMEERLNSAWSE
FSSAMAERGARLSVALMFHRSAEKLVQEIEEHRERYMREDLLEDLTAELIEEEIRRHSGT
RQAIDKEYADTVAMGQALVDRMQLPPLFGENGAPNRPPHLIEESLADLEERKMAWERVWL
DRDERLRHWLKLGDYEQQMRELLHWVKDRTSETEEKKHVIGENLTEAEALSADLQELEAR
LKEKEREVSELIQIIKSLHVASTEDQASRPYGRMADSLEEAWNDLNVQLEGRRILLDTSV
AFHHSVEKFSDKINASEDEISRVLLVEDVTSSSSLLHQHQELRKSVLELSMQTLSKGQAL
LDKLREASSHADINNRHATKAACYSVERILEALQHKRQQLDEQWKERKKVLEQCMKRCKI
DEEIRKITKWLNEEGEDYISYQDYGDSSPSTQVLLDEHYKFEEVAKEKEEACQRLARETE
KLVHGNFRDVQETQQKITLLLTNLQLFKERLEDRRKLLTDTLSFYKKNIRAHDKLDEIRD
KITEEKLTIEDQKELYGAINAASAAQLRDGKILQEKMADGKHQPVIVRMYEELQERSTAM
LVDVEPDPADKEFEDLFGWIRNVGEDFLDSNIAMGDSVKTSQEFLYSHQEMDSERQVFAD
QMAKAIDASNMQLKKDSAKVKDIQDLWMRFSARLEYRLKLGKMYFDFHRHRQLLFGKLDE
LFNQLTSDEPKENVDASPTLLARQEQLQDAILSASGQMQRESQALLDELRKEPREECLDR
GAAADCIQKFLATLEARVHKLGQLWNLREEQLNKNRQLSAEFVQFEKDTREVILWIKEQS
DTFFPVKVDYSSLPIDPRELEDKLQRFKDAARRTDEDVQAHLRAAEELSEAEGSYKAAIR
VITDELQIAYQRFKTLLADYEVLLSMSATFYTSVEKLLQMMDEMTYGLQSQPLPRDINNA
QLLLQDHLANYQTVQDLYSFTTVSAQDVLSRAATSAAVSVSRDEIKGFLERSEGRHEEWR
SLWEHHRDKLLESVRLCEFEQAISAVNLTIEEHTRELLALNRKFGITLLDAVTLLQESDS
FLESVKPADVEVGRLVEEAEKLKQLNHHDAPAIVRQVSAMEARWQRFLSRMEDHRAMLEA
SIEFHQLYEQATVWISDSEHFLKTTQDEAKRCKTEEEVIDLLDMLEGFVKPGLNKQEARL
KKLAELSAKLTMDEPRYQAKDLMTKQKHITTKFDLMDNDLFRLAERLRERKQRGLPPKAE
EVTTERVEAYEKELLETTPDTSGYEKPIRVNVLSSFVDGVLGSKRPGDWEVFEEAGPAKR
PQVSVRVRSDKPVSTETEQKIEPIIKSEIQGWFEGGKALKPVEIPEHEILVHISEDTKRE
PNQMGLAPWGVEVVKKDVTVTSLGPYVSTDIEVETALHTQTFPPSSADQAQLTRKRVWKT
TTRETTTSIKQETRTEVEMLVPEKPEMMSNLYVFGALPSSENLSVEVRSKKTVESTPDTS
ENTSPEEINRVEGGMKRANENICRKIEDSVANTHKPLQHTKHAELLIPQHAGSVLIFTPP
DTPRRGSAPYVDSSKLPNGHSVDEGQPRFESEVHLMTTPNDFNFDAVELTLPYPFMNGEA
PASDKGAKLRRMNAITDRLIESESNYVDDLKSLAEDYIYQLPNAPSQLADNKDTIFINSE
DIFFFHKVIFCDELAKCKGNPSEVGKVFKKREHELDRYITFCDGKSESDSFLESHPKDFF
KKCENEAPSRPIKELLDRPVERVLEYKAFLSDLLECGEKADVDTADIEAGKEVIDRLCAE
IRQKTKFEILLASTPKEVEFCIALDDYRDDHNNICLRKGETVVVLDRVSHPGMYKVVKLL
ADGSQGDEILVPATVLQRKKSTAEIIMPAEYTVNLRSKPGSKSPEEVSEIFVPATEREVV
EVALVEVASAPVAPVFTMPLENLKAAEGQPTHLEVRVSGTPEPRVVWLKNDLPIRTGERI
HTEKDGNLYSLKISEVDIEDGGVYTCRAKNVAGSATSMADLNVECKKIKTQSHVTARPVK
PGESEGELDVDDETDSSVLAINLNQLPQSVTLTVDGQDSTGFAPIEVQLPTPGDISASEI
HLMTESRPTSRRRSIPPEFTTELTDKTIEEGDSVEMQIFVTGTPPPEVIWYKDDQPITIY
PHRRFHATRENDICSLEIKDARCSDQGNYICRAKNTAGEVRKSCKLTVKQVTPTSPPSFV
KHLKDVHIVEGSCTRFDVKVTGMPEPEVAWFKDGVPVKQDKHLEIVHDEDTSALILMYGT
LEDAGDYACKASSEAGVAESCAHLYISPLQIPAKFTSQLESVVVSEGDPVKLKCSVLGKP
DPNIIWFKDQQQVNESSRTKMKVLSDNTCLLHILKTDMDDEGIYTCAATNSAGEDTTSTT
VTINGKGKAPEFTKALQNTEVSDGSPLCLEVRVNGKPTPFVEWLKDTKLLKSGPRFDIQT
RGNTHTFLITNCRDDDGGTYVCKARNKFGTASCEAVLVVAEDTVPPRFTKKLYDSTADSG
NTVEFSVKYIGSPEPKVKWYLDDEEVSEDDEGMDIDTEPGSSLLVLEDIAPNDSGQYKCI
ISNVAGKAVTSAQLKVSDEGKETFPTSIQRVVEAVPPPVEKRLSGKAPMFIKELSTLRVT
EGDAVRLEVIVDGSPRPVVQWFVENDHVVEDEHTHTVQEGNKYALIIDGTVLDDEAEYKC
VAKNSLGLIECTAELLVDEIAIKPEFLKELRPVEVLEGCNAQFEVEIQGNPEPDVAWFRN
NVLIEPSEKYKPSWTENVHKLVIHKTVLGDSGEFACQARNDIGLVWSVAPLTVKPGRTHG
KPPTFLEKPQSTHVMLGDVVSFEVKVEGTPMPTVKWFNEEGEEIPKTGRIFSLPSGKLAF
SSATLDDEGIYKCVAVNESGEASCQVELLVNQGNACQETEDISPSHNVVVEREVSLEGVL
GVLKEAETPLPPQIVKRLKDLSVTEGDTARFEVHITGDPTPDVEWSSSGEKIEGNEETLV
ECDGDIYKLILMDVLPDDDGEYTVTATNKIGKASCTGKLSVAEKIKKPSFLDELRNVDVT
ENTDVRLEVRVQGTEPDIDWYKDGVLIEEVTSRTEFVENEERGSYAYLIYGATSEDQGTY
RCTAVNEAGRVSCEGQLTVRENVTPPRFLQRLEDNSVVEGGAVDLEVEVSGRPRPALKWL
KDGSIVVPDDRFKIDTEGRIHTLQITQCMLSDGGKYTCTASNSGGTDTCSANLQVEKEMH
APEFVVRPEGAHIVEGSQARFEAVVSGLPEPEIEWFKDGKLVRNSHRFELEFDRNRSALT
VKGAKQTDDGEFTCTATNQVGKVSCSIELVVDEAVVAPEFVKKMTNIELCEGDLARFDVR
VSGTPQPDIKWLKNDESLRGESRYEFLSDDDMHSLELSNCLLSDAGTYRCTASNEAGETS
CTGELTVAEKLSPPVFTDEPYFPSLIEAGGDIVLEAMVSGKPTPTVEWVKDDTALKNSSQ
FNIKAKDDKHTLTISSASPADSGAYKCIAHNTGGTSTRTFNVNIEGAKPISSTPEITKEL
DEVEVLQGQPITLECHVSGASDAHVKWFHDNVLLTDNERITTSFDGVVCVLTIQRSILDD
EGDYLCQIENDQGVVSSSSEVIVDEGMALPIFKEPLKNTSITEGENVCFDIRVVGNPEPV
VEWFKDGVQLEDEGRIMIIDDVDDDQPELFSLVIEKCEQSDVGLYKCIAMNEAGKDSCSA
QLQVTSSSVAQKSPDIAKIPVDVTEGQDVTLKALTSAQLPKVIWLKDDEPLMQSTHYDID
AKQGIHTLTIRNALPEDSGIYKFDTNDDSTSIFKVTIKGKDSLDGVAPEVTTVNSPVEVL
EGSTAKLTCVVTGTPYPKVTWLIDGSPVETSERVIFDYDGEFSSLLFLSTELDDEGEYQC
KAQNEIGSAISTMELLVNELSDLEDQSKPAFSEKLKEVSTFEGDTAVFSVKVQGFPLPDV
QWYSSEREILKNERFVTDSAVDGRHTLTINDCVTKDKGRYKCVASNVVGKAVCSAGLTVK
EKLIPPQFSDQDSGAPMLIDEGSDVMLQVEVTGKPKPSTKWYKDDQPISRTSSKYKTDVL
GERQSLNIVAATPEDSGIYQCRATSPSGTITRTFDVNIKAKQPEGESPKFIQPLKSKKVF
EGSAAKLEVRISGEPEPKVEWFKDEQPIEEGGNFRIEFDDTDGCTLVINSTKTSHEGLYK
CVASNSFGKANSEAELLVTGDDENKVESPENLVTVEKSVPISSVPFGPVEVALPVKEESL
PSTYKEKREVSEKELPQSRPSFEAVQLVLPGPGDVPLIPDTISALEYEPVQLTLPGANEP
ILPDFMDVPNDLKVNEGAKVVLKVRVIGQPVPEVTWFVDDEPVQPSDNISIRSDGDKHEL
IIHEAEVDDEGMYKCVAKSEAGKAICEVELLVEEARKPKTEESLEVQITKELEDVEVDEG
EPATLEICFVSRDKPAVSWFKGMKPVEPNKRVKIITDEQSSKLIIKKTVGEDEGLYKCSV
KSGTWEMNSSAELIVEEPSDDEKVILRKPVLVQKFSDGDIVEGEKLELQIKVIGSKPVTV
TWYRDDEKIEADDHCKLLSDDEIHVLRVNQAEIDDEAIYKCVVKNPAGQDQCEAQILVEE
KTDSVEFVDAEFSENAPHFISRLPEEIEVLEGDLTRLECRIGLAAEVSWFKDDEPLEEDD
RITIENEGDASAVVISCTELDDEGDYKCVVQNEFGRAMCQTEVIVEEGVSMPLIKESLKN
LEANEGDVVKFEVRITGNPEPVVEWFKNGSQLQDEGRVIIVDDADDNDEELFCLVIEDCK
VGDSGTYKVVAMSEAGTANCECSLNVTRTQVPPEFKDEMEEVPMEGSQGDNVSMVVNTGR
LPSPVIAWFKDEEPVVSSSHLEISHDPDHSKLMVHHVTPEDSGTYKCVATSVMGTITKKF
LLNIEGSEPKLEQTISTSDLQAEPVRDVAAPVFLKKMDAVVINAGEEARFDVRVSGVPEP
KVVWYRGSNEVKDEGRFVHIDAIEEDLFTLVIESSESGDAGQYKCVASNEAGQTSCEAQL
IVREKEVDKKPLNENVQAKPREEAPNFSQPLQTVEVIEGTEATLKCMVTGNPEPNIAWFK
NGDTVAEEKRYKTRYNGEQATLKIQNTELDDEGEYKCVAENHLGSASCSAELLVNEPNTM
PEFEEKMKPVDVIEGELAKFSVKVAGNPPPVIDWFKGKDKLEDEGRIEIIDDEDSGNYTL
IINDTLLGDAGTYKCIALNEEGERSCKAALAVKEAVTKPEIVIEPEATPLKVAEGDVVSL
SAIVKGKPVPTVDWYKDDEKLRETSRLKIDAKDGEHSLLILEAKPEDSGVYKCQAKSKGG
NVEKTYHVDIKAAPPEGIAPVFIESLQTVEVVQGSPAKLQCRVTSKPEPTIDWFRDNEPV
KEDKRIKIRFDGELCTLKILETELEDEGAYKCFAKNEFGSVSCTSELLVNEPYKKPEFTQ
RMKPVNVTEGEAARFDVTVEGNPIPVVDWFRGKDKLEDDGRYVMMNDEEAGISTLIIEDT
LLEDAGTYKCIAANEEGQASCKAALAVKEKMMTPEFTDEEQSLPFNFMEGDEARLTVGIK
GKPVPTVEWYKDDKKVRKTSRIRMDEKDGKFSLVILDVTSEDKGSYRCEASSKAGTVTRR
FDVNVAEKSPEGKAPEIVEPLKFVQVLEGSPAELKCQISGQPKPTVEWLRGNEKVKESER
IQFVSNNETFSLNFKEAELDDEGDYKCVAQNEFGSVSCWAEFLVNKPAAKPEFREKMKHV
TVQVGQQARFDVLITGVPKPQVDWMKDGKILEEPAERFTFLDDEDEEDEGRSSLTIEDVK
LEDAGKYGCLAFNEEGEVFCEANLLVQETLIAPAFVDEAESAPILAEEGGEINLSAELRK
SQPELKVEWLKDDKTIKEDQRLNRFVIEDTHMLKITGVVPEDSGLYKLKASGKAGSVERE
FDVQISAKQPEGDEPQFTEPLQAVEVKEGDATKLHCTVTAEPPPTFEWLKDGVRVKESRR
VKVDSDGMTSSLSFKDARPDDKGEYKCVASNAFGSASCAAALKVMVLSKPDFKEKLGGVE
VVEGDCASFDVVVVGYPEPFVEWYRGTIKLQNDERTEIKEVKDLARFSLTIKDVSRDDAG
IYKCVASNEAGKTTVRGELSVKERLFAPEIPEGQEEAPITVTEGDDCNLNTTIVGKPKPD
VKWYKDDKPLRESTRLDIKARGDKHSVVILGIQTNDSGVYKCEAKSKMGTATRKFDVRVR
AEKPKGIAPEILTPLQNLTVVEGKPANLECEVKGEPQPNIEWFKDGEQVKQSERINLNFE
GNFASLSFKPAELDDEGEYKCVARNELGSASSEAELLVEEAETKPDFKEELKNISVLPRA
EARFDVRVVGVPPPEVDWFKGKQKIEDEGRFILIDDEEDDLFSLVIEEARPSDSGEYECV
AFNEVGEVSCKSKLIVGETLIPREEAESALPAVEESITVPESAAKVESALVMEQEGGDVK
AKKPGGKAPVFSESLQSVEVKEGSDAKLQCTVTAEPKPNIEWFKKGVRMKENRRVKFESD
SDSFAVTIRDARSFDEGEYKCVATNEIDSASCAATLTVRVVAKPEFKDKLKRVEVMEGDS
AQFDTRVVGYPVPELQWFKGISKLKSEGRIEFKENSEDNMFSLEIRDTQRDDAGMYKCEA
SNEGGKTTCRADLIVKERLFAPEISGDQSEAPLTVTEGGEVSLDVTINGKPKPDVKWYKD
DKPLRESTRLDIRARGDKHSVVILGIRADDSGVYKCEAKSKMGTATRTFDVRVQAERPKG
SAPEFTFPLQSVEASEGTKVKLSCTLKGTPQPTIQWLKDGEPLETNKGVTADFDGELASL
SFSAAELDDEGDYKCIAQNELGAASCSAELLVNEADSKPEFTEAMKDIEVAENKEGRFDV
RVTGYPKPAVQWLKGADKIEDAGKYILIDDEEDDLFSLVIDDVSPDEAGTYTCKVTNNVG
EAVCEAELKLKESIAAPEFADEEETGPITAVEGGEVTLSVAVKGKPRPDVEWFKNDKPLK
KTSRLDVRSRDDKFSLVVMNVSPEDSGLYKCVASSRVGRVIRTFQVNIEGKKAKKPKGVA
PQVTQPLKATQIVEGNPVRLKCRMTGSPEPTAEWLKNGEQVELSQRIKADVIGDMCQLSF
AETQEDDSGSYKCVIINDLGSTFSEAELVVTIPIVAPKFKEKLKGLQVNEGEQVQLDVRV
SGNPTPNVSWFRGPQAIINEGRFIVKADDGDELYSLIIDETTLDDSGTYKCVASNEAGKA
TCRGELEVNEKLTAPEFAGVFSDAPVIFREGEEVSMEVTIRGKPAPDVEWYKDELSVRKS
SNMTTLVKGEKQTLLIYNAKPADSGVYKCVAKSNMGTAMRTFNITVEAKKPKGSAPEFFK
PLKKIEVVEGSSAKLEGWVHGKPEPSIEWYKDDELVTSNRRVKTYFDSEVCRLTISDTVA
DDEGEYKCVATNELGSVSCSAELLVNEAIIIPEFEEKLKHTEVIEGDTARFDVCVVGNPK
PVTEWSKGGKAIVSGGRFKIVYSEDSNVHSLFIENVSLDDFGSYKCVASNEAGRMQCSAR
LDVKERQIAPEFSDEYGDSPIEVKEGDELKINVTIRGNPSPDAEWFKDDKPFKRTSRGNI
SARGNKFGITIFTVTPEDSGVYKCVAKSAAGTTTKTFQVDIEGKKPAPRFTQPLEETQAT
IGGTARLKCRLNATAKPNIEWKKNGQPVSENRRVKTELEGELISLVISDARFEDSGEYQC
VVKNKSGTASCSTRLFVSESTSKPEFKKVMNDLELLEGDDAVFEIAVNAKPDPKVQWFLR
KMPIKSEGKYTIDEDSERQRFSLTISDCHTEDSGQYRCLVTNSAGEVASSAELKVSDRQV
APRFIQGTEEQLFEVWEGAPVKLVVQARGKPTPQVEWFKENRLARRVKRVELETEDDQSI
LLIPKAVPDDSGNYRVEATNSAGTAVKPFVVKVNAQKLVLRREPVPAGAVKPEFIQRLQD
VEIVEGSAAKFDVRVKGTPEPEVDWYKDNRVIREGGRMRFLFEDDGLCSLLIREAESSDR
GRYKCVASNPAGKVQCSAELFIESHGFDSTSGSDHERRLSRESTFDMLSDDTEDEVESSS
SSGPPKLPPDITLVLRNRDVKEGGVTKFACRVVSSSSVTAEWYKDDQLVNKWPRFTCERD
EDLYALNITDAKRTDAGHIRFVARNEFGQVESNAYLNVEPDMEPEFEGNTPRFIQKLKDV
DAVPGKTARLECRVIGDPRPDIRWYRENEPLLEGGRYKFEDDDDRQVLVIDDVCGSDEGM
YKCVARNSAGKAHCSADLYILQTDDEESESAGEQELEEEKRKQRVSTEASPVIETLISPD
SAQVEKSEPPLPTTLKTQSKPEPPKPKERLRQPEFILKLRDKSAVEGSSVRLACRAMGTP
EPGFQWYKDGEPISAGGRFDINQSVSGFTLVIKECQLEDSGEYQCEATNKVSSVSTSAKV
TITALSKPRQEVTVSPKFEQNFTETKITEGEDIKLTAKVSGNPVPDVIWQKGGKPIREGR
RIKIDKSKNGVHSLRIPRAQADDGGEYTCIARNKAGEASCSAKLTVEAPKPEIKEGVMSL
PKKPVDEDIVVMATDIPVSRERELESGTPATPPKFDQTMQTAEVVEGSAARFDVTVTGSP
VPKVRWLKDDKLLEENRKIRFDEDDDGVFSLFVNDVVVDDEGVYKCEATNVKGEVTCSAE
LIVEGLEESTGDESEETSEDELQSKEELPIKEAPKPTDKKVAPPPAPKPKPAVKSVPKPV
FSSELQDKQVKEGDNLTLDVRVPLECKAEVTWYKDDHALKEDHHIAIISAGEMQAVNIFD
VSVKDEAVYRCVAANDDGSVSTDCEVLVEEKVKVPQTVMNRGRLSQMAPEFVQECSDLCV
VKNSTAQLEIIAAGSQPLQIRWFKDNEPIKYGKRLKLSSDGEHCSLKISPIEIQDQGIYK
CVISNKAGTQSCEAKLTVGESVDFKESTDGTAPGSPVAKRPSRSKSGAKPTIVSPLEDIE
VNDGENVTLEVTSGPEPIDNIEWFKDNDLIRSQPRFTQSSAGEQHTLDIQSVTVDDEGIY
KCVLLNSWGIASCSAEVLVEESMSESSSQDDEQLEKFNARMERRRSRDSVCEPEFQQELS
NSDVFVGDTVYFTVKSRGIPEPKVSWYRNGELVKEDSRVKFIKDSQSGNYSLLINKVTVE
DEGEYRCVASNMGGSVACQAKLLVKGHNQDEAPSFTAPLTDRSIEDSSAARFDVRVRGKP
APTVSWYKDGKEISDEQFPHIKVLQEEDLFSILITEGKFEDAGTYKVVAKNVLGEVSSTG
MLFVEGADQLPPFAGGKPPRKNSGLSRVEEVLTLKLYTAIEDFYSEETGNKFLKRGDKVE
VLDTSRPEFWLVRRVSRGSEIGFVRHTCLKRDEDGDETTDAPVIGEKQKFVCITNYTAQS
PDEVSVNEGDMLEILDDVGMENSMVCVIPTGAVGWLPRVFIIRAPEEDVKKAPKTAKGKE
REALNQREFVLNELIESERQYVNDLRTVVESHLAELDAADIPEEVVEHEDVVFSNIKEIY
GFHTRLFLHELEACAKSPDDVPKVIVRHKPKFEMYIKFLEGRPLANEKLESEKTQEFWTE
FQEDTKDAISLSEYLKKPAQRLDEYVLHLKELLKFTVRANLQHSDFQTALEFLASLSRRG
NEAAQKFHIEGYNGEVPLENLGRLIRQEVVLFWEEKARGKGKERDLFLFEKGIVNTKRKE
GGRKFIFKNMLKLTSGNVGLTEHVEGGARQFMVWVGTSMATALVLHTFETKTEWSKQVWV
REIKRLLHLSEKSLNTAVTPSLVFGELEVQLPSTSATEGNLVTTVKETITSPSYSRLIAE
LEKQYVAITPPDSPEPQSLNIQLGGTYHLSEETLERDTRERVIGRGEQVRVLRSGRDLYF
VQTVKDGETKEGWVPGSWLLERGFDDQITGAQVQVELEAGLEDDIAQDLSSEASEPELQR
LKETGEGK
NT seq 31347 nt NT seq  +upstreamnt  +downstreamnt
atggttataattgaccttaggggctcatcctggaaatctgccaaacctcttctaagaact
cttcaggaaacagttccagacaaggtacatgaagtctatattattaagccagatgctttc
tgggaaaaacgacgctcaggaactggtcttagaaaggaacaatctagtgttgcatttgag
acgacattgttgtcatcatcaagtaaacttcatcagtttgctgagggaagtcaaattact
caagagctgggtggtactttatcatataaccataacagatggattgatactagattggaa
attgagaaaatttcagatgagtcagtctctttgaatgaaaaatttgatgaattggaacaa
gacctagacacccatcagctaggtaacgacatagcagaaacagatggcctgattcgtcaa
catgaaaccaaaagggcattgttagataatgttgcttatccactgatccaaagaggagaa
catcttatcagctcaattaaagctaatgaacctcctataccacccagccaaaatttcact
ggtagtcctgcttctttaccaagccaagagcgtcaacaggtggaaggtaatgtgactcaa
ctaaagctgaggtgcagccagttgatggacatgtgggaaaagagatggaaagagttgata
cagtgtatggatctactggagtttgatgcaggatatcaaaaggtgacaaactgggtcctt
gggtcaggagagtcatatttagccaattccaatgatattggagactctgttatctcttgc
gagatccttaggaaagagcatgaggaatttgagttgtctgccagggaagtgataaaccac
tttgctcaggtgcgtgaacttgccaagaaaatgctccaggaaaatcactatgcctccaga
gatattaaaagtcgcaaggaattcctggacagaggttgtcgaaactttgccctgcggatg
aacaggagaagagacatcatactgacatcacttaaatttcacaagagtgcaggggagtgc
tcagttaatttggatgacttatttgaactgctgtgttctgattctgttctcatgtacgac
tatgagactgcagagagcatgctcagaacattggaagagaaggctgaggcggttgccatt
tcgtctgaagacaccttgcgagatgcattggccgtgcaggaactgatgacaagtccaatg
tccaatatgcggggtgatgacgtcactcaggattatgggaagggtattgcgcatgtgcgg
cttactttagacgaactaagagagcggaaactacgcacggatgagttgtgtgatgtgcgc
agaatcaaactgcagcaactgttgcagctcaaacagagcgaacgagacgctgagcaggcg
actgtgtggataagtcaactgcgtgacgctacagaacataacttgggagatgtgggaaga
aactcagaggatatcgaggctttgcaacaggaacacgagaaacttgagactacagctaaa
agtacttatgattatggtcgacaatttctccaggcctcattagttcttcgccgcacttgt
cgctatgaattgactccaaactaccaaatggaggaaaggttaaacagcgcttggagtgaa
ttttcatcggccatggctgagcgaggagcaagactgtctgtggcgctcatgtttcatcgg
agcgcggagaagcttgtccaagaaattgaggagcacagagagagatacatgcgagaggac
ctcctagaagacctcacagctgaattaatcgaggaagaaattcgccgacactctggcaca
agacaggccatcgacaaagaatacgctgatacggttgccatggggcaagccttggttgac
agaatgcagttacctcccctgtttggggagaacggtgcaccaaatcggcctcctcatctc
atcgaggaatctctggccgacttagaggagagaaaaatggcctgggaaagagtttggcta
gacagggacgagcgcctacggcattggttgaaactcggagactatgagcaacagatgcga
gagcttcttcattgggttaaagatagaactagcgaaacagaagagaaaaaacacgtgatt
ggtgaaaacctgacagaggctgaagcgcttagtgcagacctacaggaactggaagcaaga
ctcaaggagaaagagagagaagtttctgagctcattcagatcatcaagtcactacatgta
gcctcaacagaagatcaagcttccagaccctatggaaggatggcagattctttagaagag
gcctggaatgacctcaatgttcaattagagggaaggagaatacttcttgacacatcagtg
gcttttcatcacagtgtagagaagttttctgacaaaatcaatgcctcagaagatgagatc
agccgagtccttttagtggaagatgtgacatcatcatcatcattacttcatcaacatcaa
gaactaagaaaaagtgtattggaattatccatgcagactttatccaaaggacaagctctc
ttggacaaattacgagaggccagttcacatgctgacattaacaatcgtcatgccacaaaa
gcagcatgttacagtgtggagcgtattctagaagcactacagcacaagcgacagcagctt
gatgaacagtggaaagagagaaaaaaagttttggagcagtgtatgaaaagatgcaagatt
gatgaagaaataagaaagatcacaaaatggcttaatgaagaaggagaggattatatcagc
tatcaagattatggagactcatcaccttcaactcaagttcttcttgatgaacactataaa
tttgaggaagtggcaaaggaaaaagaagaggcttgccagaggcttgctcgagaaacagaa
aagcttgtgcatggaaatttcagagatgtacaggaaacacagcaaaaaattaccctgctt
ctaacaaacttgcagttattcaaagaacgtttggaagacagaaggaaactactgacagat
acactatctttttacaagaaaaacatcagagcacatgataagcttgatgaaataagagac
aaaattacagaagagaagctaaccattgaagatcaaaaggagctgtatggagcaattaat
gcagcatctgcagctcaactgcgagatggaaagatactgcaagagaagatggcagatggg
aaacaccaacctgtcatagtgagaatgtatgaggaactgcaagagcgcagcacagctatg
cttgttgacgttgaacctgatcctgcagacaaggaatttgaagatctctttggttggatt
aggaatgttggtgaagactttcttgatagcaacattgcaatgggtgattctgtcaaaaca
tcacaggaatttctgtattcacatcaagaaatggattctgagagacaggtttttgcagat
caaatggccaaagctattgatgcatctaatatgcaactgaaaaaagatagtgctaaagtt
aaagatattcaggatctgtggatgaggttttcagctcgacttgaataccggcttaagttg
gggaaaatgtactttgatttccatcgccacagacaactgctgtttgggaaattggacgag
ctcttcaatcagctgacaagtgatgagcctaaggagaatgttgatgcatcacccacatta
cttgcacgacaagaacaactgcaggatgccattctttcagcatctggacaaatgcagagg
gagtcacaggcacttcttgatgagttgcgaaaagaaccaagagaggagtgtttggacaga
ggggcagctgctgattgcatacagaagttcctggcaactctagaggcgagggttcataag
cttggccagctttggaacctaagagaagaacagctaaacaagaacaggcagctgagtgct
gagtttgtgcagtttgaaaaagacacgagggaggtcatactatggatcaaagaacagagt
gatacatttttccctgtcaaagtagactacagctcccttcccattgacccaagagagtta
gaagacaagctgcaaaggttcaaagatgctgcaaggcgtactgatgaagatgtccaagct
catctgcgcgctgcagaggagctgtcagaggcagagggtagctacaaagcagccattaga
gtcattacagatgaacttcagattgcttatcaaaggtttaagaccctgctagcagattat
gaggttttgctgtcaatgtcagcaacattttacactagtgtggaaaaacttctccaaatg
atggatgaaatgacatatggccttcaaagccaacccctccccagagacatcaacaatgcc
cagctcctgctacaagaccatcttgccaactaccagacagttcaagacctgtacagcttc
accactgttagtgcacaggatgtcttgagccgggctgccacttcagcagctgtctctgtg
tctcgtgatgaaatcaagggcttccttgagagatcagaaggaagacatgaggaatggagg
tctctttgggagcaccatagggacaagttgttagaaagtgtgcgattgtgtgaatttgag
caggctatcagtgcggtcaacttgaccatagaagagcacaccagagaactgcttgctttg
aacagaaagtttggaatcactttacttgatgctgttactctgcttcaagagtcagattca
tttctagagtctgtcaagccagctgatgtggaagttggtagactggtagaagaagcagag
aaattgaagcaattaaatcatcatgatgcacctgccattgtgcgacaagtttctgcaatg
gaagcccgctggcagagatttttgtccaggatggaagaccatagggccatgcttgaagca
tcaatagagttccatcaactttatgaacaggcaacagtttggatcagtgatagtgagcac
ttcttgaaaaccacccaagatgaagcaaaaaggtgcaagactgaggaggaagttatagac
cttctggacatgttggaaggatttgttaagcctgggcttaataagcaagaggcacgactg
aagaagttggctgaactctctgcgaaacttacaatggatgagcctcgttaccaagcaaag
gatcttatgaccaaacagaaacacatcactacaaagtttgatctcatggataatgacctt
tttcgtttagcagagaggctcagggagagaaagcagcgaggacttcctcctaaggcagaa
gaggtaacaacagagcgtgtggaagcttacgagaaagaattgctggagaccactcctgac
acgtcggggtatgaaaagccaatacgtgtaaatgtgttgtcatcatttgttgatggagtc
ttgggtagtaaaagacctggggactgggaagtatttgaagaggctggaccagccaagcgt
ccacaggtttcagtgcgagtgagatcagacaaaccagttagtacagaaacagagcaaaag
atcgagcctatcatcaagtcagagatccagggttggtttgaaggtggaaaagctctgaag
ccagttgaaatcccagaacatgagatactggttcatatcagtgaagatactaagcgagaa
cctaatcagatgggtttagctccatggggtgtagaagtggtaaagaaagatgttacagtg
acttccttagggccttatgtcagcacagacattgaagtcgaaacagccctccacactcaa
acatttccaccatcttcagcagaccaagctcagctaactagaaaacgtgtatggaaaacg
accacaagggagaccactacaagtatcaagcaagaaacaagaactgaagtagagatgttg
gtgccagaaaaaccagaaatgatgtcaaatctctatgtatttggtgctttgcctagttct
gagaatctgagtgttgaagtgcggtctaagaaaactgtcgaaagtacaccagacacctca
gaaaataccagcccagaggaaataaacagggtggaaggaggcatgaaaagagctaacgag
aacatctgtcggaaaattgaagactctgtagcaaatacccacaaaccattgcagcatact
aaacatgctgagctgctcataccccaacatgctggttcagttctgatcttcacaccacca
gataccccacgaagggggtcagctccttatgttgattctagcaagctaccaaatggccac
tcagttgatgaaggtcaaccgaggtttgagtctgaagtgcatctcatgacaacacctaat
gacttcaactttgatgctgtggagttaactcttccatatccctttatgaatggggaagcc
cctgcctcagacaaaggagctaaactgcgtagaatgaatgccatcactgataggttaatt
gaaagtgagagcaattatgtggatgacttgaagtcacttgcagaggattacatctatcag
cttcccaacgcgccatctcaattggcggacaataaagacaccatctttatcaattcagaa
gatatattcttcttccacaaagtgatcttttgtgacgagttagcaaagtgcaaaggaaat
ccatcagaggttggaaaagtgttcaagaagagggaacatgaacttgacagatacataacc
ttttgtgatggaaagagtgaatcagatagctttttggaatcacatccaaaggatttcttc
aagaaatgtgaaaatgaagcgccttctcgtcccataaaagaactcttggatcggccagtt
gaacgtgttttagaatataaagcctttcttagtgatctgctggagtgtggggaaaaggct
gatgtggacacagctgacattgaggctggcaaagaagtaattgatcgcctttgtgcagaa
attcgtcagaagaccaagtttgagatccttttggcttctactcccaaagaagttgagttc
tgtatagcattagacgactatagagatgaccacaacaacatttgcctcaggaaaggagag
actgtggttgttttggatcgagtgtcacaccctggaatgtacaaagtagtcaaacttctc
gcagatggttcccaaggcgatgaaattttggttccagcaacagttcttcagcgtaagaag
tccacagcagaaatcataatgcctgcagaatacaccgtgaatctcaggtctaagcccgga
tccaaatcgccagaggaggtttcggaaatttttgtccctgctacggaaagagaagttgta
gaagtggcactggtagaggtcgcatcagctccagttgctccagtattcactatgccatta
gaaaatcttaaggcagctgagggccaaccaacacacctggaggttcgtgtgagtggtacc
ccagagcctcgagtagtatggcttaagaacgaccttcccatcagaactggagagcgcatt
catactgagaaggatggcaatttgtacagtttgaagatttcagaagttgatattgaggat
gggggagtatatacatgccgtgctaaaaacgtagctggatcagcaacttccatggcagac
ctgaatgttgaatgtaagaagataaaaacacagagccatgttactgcacggccagtcaag
cctggtgaatcagagggggaacttgacgtggatgatgaaactgacagctctgttttagca
ataaatctaaatcagctaccccagtcagtgacattgactgttgatgggcaagatagcact
gggtttgcacccatcgaagttcaacttcctacacccggtgatataagtgcttctgaaatc
catttgatgacagagagtaggccaacatctcgtcgaaggtctattccccccgaattcacc
acagaacttacagacaaaacaattgaagaaggagactctgtagaaatgcagatctttgtt
actggcacacctccacccgaagtgatttggtataaagatgatcaaccaatcacaatttac
cctcacaggcgcttccatgcaaccagagaaaatgacatctgtagcctagagatcaaggat
gcgagatgcagtgatcaaggaaactatatatgccgagcgaagaacactgccggtgaagtc
agaaaatcctgtaaactaactgtaaagcaagtcactccaacaagccctccttcctttgtt
aaacatttaaaggatgtgcatattgtggaaggctcttgcactcgtttcgatgtgaaagtc
acaggaatgccagaacctgaggtagcttggtttaaagacggagtgccagttaaacaagac
aagcatttggaaattgttcacgatgaagacacgtctgctttgattcttatgtatggcaca
ctagaagatgcaggtgactatgcttgtaaagccagtagtgaggctggggttgctgaatca
tgcgcgcatctgtacatatcacctttacaaatacctgccaaatttacgtcacagttagaa
agtgttgtggtgtctgagggagacccagtcaagctcaagtgctcagtgcttggaaaacca
gatcccaatataatttggtttaaggaccaacagcaagttaacgaaagtagcaggacaaaa
atgaaagtgttatctgacaacacatgcttattacacattctcaagacggacatggatgat
gaggggatttacacatgcgctgcaacaaattctgctggagaggatactacctctaccaca
gtgacaataaatggtaaagggaaagctccggagtttaccaaagccttgcaaaatactgag
gtttcagacggcagtccactttgtttagaagtaagagttaatggaaaaccaacaccattt
gtagaatggctgaaggacacaaagctgttaaaatctgggccacgctttgatatccaaaca
agaggaaatacacatacatttctaattacgaattgtagagatgacgatggtggtacgtat
gtgtgcaaggcaaggaacaagttcggtacagcctcttgcgaagcagtgctagtggttgca
gaggatactgtaccaccaagatttacaaagaaactctacgactctacagctgattctggt
aacaccgttgaattttctgtcaagtacattggtagtccagagccaaaagtcaaatggtat
ttggatgatgaggaagtttctgaagacgacgaaggtatggacattgacacagaacctggt
tcatctttgctagtactagaagacatagcaccgaatgactctgggcagtacaaatgcatt
atatctaatgtagcaggcaaagcagtcacaagtgcacagctcaaagtgagtgatgaaggt
aaagaaacattcccaaccagtattcagcgggttgtcgaggctgttcctcccccagtggaa
aaaaggcttagtggtaaagcacctatgttcattaaggaactttcaactctccgtgttact
gagggagatgcagtccggttggaagtaatagttgatggctcacccagaccggttgtgcag
tggtttgttgaaaatgaccatgtggtagaagacgagcatacacatacagtccaagaggga
aataagtatgctttgattattgacggaacagtattggacgacgaggctgagtacaagtgt
gttgccaagaattctctcggattaatagaatgtacagctgaactcttggtggatgagata
gctatcaaacctgaatttctaaaagaactgaggccagttgaagttttggaggggtgtaat
gcacagtttgaagtggagattcaaggaaatcctgaaccagacgttgcatggtttagaaac
aatgttcttattgaacccagtgaaaaatacaaaccaagctggactgaaaacgtccacaaa
ttggttattcataaaactgttctcggtgattcaggggaattcgcgtgccaggcaaggaat
gatattggtttggtttggagtgttgcacccctcactgttaaaccaggaagaactcacggg
aaacctccaaccttcttggaaaaacctcaaagtacacatgtaatgttaggggatgttgtt
tccttcgaggtgaaagttgaaggtacgccgatgcctactgttaaatggttcaatgaagag
ggtgaagaaattccaaaaactggtcgtattttttccttgcctagtggtaaattagcattc
agttctgcgactctagatgacgaaggaatctataaatgtgttgctgtcaatgagagtgga
gaagcgtcatgtcaagtggagcttttagttaatcaaggaaatgcttgccaagaaactgaa
gatatttctccgtcacataatgttgttgtggaacgtgaagtatcccttgaaggtgtgctc
ggcgttctaaaggaggcagaaacgccgctaccaccacaaatcgtgaagaggttaaaggat
cttagtgtaacagagggtgacacagcacgttttgaagtgcacattactggagaccctaca
cctgatgtagagtggtccagcagtggtgagaagatagaaggaaacgaggagacccttgtg
gaatgtgatggtgatatttacaaacttattctgatggatgttcttccagacgatgatgga
gagtacacagtcacagctacaaacaagattggaaaggcgtcatgtaccgggaaactctct
gtcgcagagaagattaagaagccttctttcttggatgaactgaggaatgttgacgtaaca
gaaaatactgatgtgcgcctggaagtacgagtacaaggcacagaacctgatattgattgg
tacaaggatggcgttttaatcgaagaagttacgtcgagaactgaatttgttgagaacgaa
gagagaggaagttatgcttatctcatttacggtgccacatcagaggatcagggcacctat
cgttgcacggcggtaaatgaggccggccgtgtgtcgtgcgaaggacaactgacggtgaga
gaaaacgtcactcctcccaggtttctccagcgcctcgaagacaactcagttgtggaggga
ggtgctgttgacttggaggttgaggtcagtgggagaccaagaccagctttgaagtggctg
aaagatgggagcattgttgttccagatgatcgttttaaaatagacacagaaggccgtatt
catacattgcagataactcaatgtatgctttcagatggagggaaatacacttgtactgct
tctaacagtggcggcacggatacttgctctgctaatctgcaagtcgaaaaagagatgcac
gccccagaatttgttgttcgacctgaaggagcacacattgtcgagggaagccaagccaga
tttgaggcagttgtttctggtctaccagaacccgaaattgagtggttcaaagatggaaaa
cttgtacgaaacagtcaccgctttgaactggagttcgacagaaatcgatccgctcttact
gtgaagggagcaaaacaaacagatgacggagaattcacgtgtacagctaccaaccaagtt
gggaaggtttcttgctctatagaacttgttgttgacgaggcagttgttgcacctgaattt
gtcaagaaaatgacaaatatagagttatgtgagggtgacttggcacgatttgacgttcgg
gtgtctggcacacctcaaccagacataaaatggttgaagaatgacgagtctttgcgaggg
gaatcacgatacgaatttctctccgatgatgacatgcattccttggagttgtctaattgc
ctgttatctgatgctggaacataccgctgtaccgcctcaaatgaggcaggagaaacgtct
tgcactggcgaactcactgttgcagaaaagctgtcccctccagtgtttacggatgagccc
tattttccaagtttgattgaagctggaggtgacattgtgctagaggcgatggttagtggt
aagcctacaccaactgtggagtgggtcaaagatgatacagctcttaagaacagcagtcaa
tttaacataaaggccaaagatgacaaacataccctaactatttctagtgctagccctgct
gattctggagcttataagtgcatcgcacataatactggtggaacgtccacaaggactttc
aacgttaacattgaaggtgcaaagccaattagttcgacgccagaaatcaccaaggaactt
gatgaggtagaggtacttcaaggacaaccaatcactttggagtgtcatgtctctggagct
tctgatgctcacgtgaagtggtttcatgacaatgttcttctgactgacaatgagcgaata
accacctcattcgatggtgtggtttgtgtcctgacaatccaacgctcaattctagatgat
gaaggggactatctgtgtcagatagagaatgaccaaggtgtcgtgtcaagttcttctgaa
gtgatagtggacgaaggaatggcgttaccaattttcaaagagccactgaaaaacacaagc
attaccgaaggcgagaatgtctgctttgatatccgtgttgtaggaaacccagaaccagtc
gtggaatggtttaaagatggtgtacagcttgaagatgagggccgtattatgataattgat
gacgtggatgatgatcagccagaactcttctctcttgtaatcgaaaagtgtgaacaatca
gatgttggtctgtacaaatgtatagctatgaacgaagctggcaaagattcgtgtagtgct
caactgcaagtcacctcttcatcagttgcacagaagagtccagatattgctaagattcct
gtggatgtcacagagggccaagacgtaacactgaaggctttgaccagtgcacaacttccc
aaagtcatttggcttaaggatgatgaacctttgatgcagagtacccactatgatattgat
gctaaacaaggcatccatactctgacaataagaaatgccttacctgaggactctgggatt
tacaagtttgatactaatgatgatagcaccagtatcttcaaggtcaccattaaagggaaa
gattctttagatggcgtcgcaccggaggtcacaacagtaaatagtcctgtggaagtactt
gagggaagtacagccaaactgacttgtgtggtcactggaacaccatatccaaaagttact
tggctaatagatggtagtcctgttgagacaagtgagcgtgtcattttcgactacgatgga
gagttctcatcacttctcttcctaagcactgagctggatgacgaaggagagtatcagtgt
aaagcacagaacgagattggatcagcaatcagcactatggaacttctggtaaatgaactc
agtgaccttgaagatcagagtaaaccagcgttttcagagaaattgaaagaggtcagcaca
tttgaaggtgatactgcagtctttagcgtaaaggttcaaggctttccacttcctgacgtt
cagtggtactcgtctgaacgggaaattttaaaaaatgagcggtttgttacagattcagct
gtagatggtcgccacacgctcactatcaatgactgtgtaactaaagacaaagggagatac
aaatgtgttgcatccaatgtagttgggaaggctgtgtgttcagctgggttgacagttaag
gaaaagttaatcccaccccaattttcagaccaagatagtggagctccgatgttgattgat
gaaggaagcgatgttatgctgcaagttgaagtaactggaaagccaaagccgtccactaag
tggtacaaagacgaccaaccaattagtcgaaccagtagcaagtacaagactgatgttcta
ggagagaggcagtctctcaatattgtcgctgcaacaccagaagactctggaatttatcag
tgtagagctaccagcccgtctgggacaataacgagaaccttcgatgttaatataaaagca
aaacaaccggagggtgagtctcccaagttcattcagcccttaaagtccaagaaggtgttc
gaaggtagtgccgcaaagcttgaggtcaggatatcgggtgagccagagccgaaagtggag
tggtttaaagatgaacaaccaatagaagaaggtggcaacttcagaattgaatttgacgac
actgatggctgtacgctcgtcatcaattctaccaagacgagtcatgaaggtctgtacaag
tgcgtggcttcaaattcatttggaaaagctaactctgaggcagagttgctggttacagga
gacgatgaaaataaagtggagtccccagaaaacttagtaacggtggaaaaaagtgtaccg
ataagttcagtaccttttggaccagtggaagttgcactcccagttaaagaggagagcctt
ccttcaacctacaaggagaaacgtgaagtgtcagagaaggagcttccacaaagtagacct
tcttttgaagctgttcagcttgttttacctggaccaggagatgtgcctttgataccagac
actatttcagccttggaatacgagccagttcaactgacactgccgggtgcgaatgaaccc
attctgcctgactttatggatgttcctaatgacttaaaggtaaatgaaggcgccaaggtg
gttctcaaagtgagggtaattggacaacctgtgcctgaagttacatggtttgtagatgac
gagccagtgcaaccaagtgacaatatttctattcgttctgatggagataagcatgagctt
attattcatgaggcagaagtggatgatgaagggatgtacaaatgtgtagcaaaaagtgag
gcaggaaaagctatctgcgaagtggaattgctcgtagaagaagcaagaaagccaaaaaca
gaggaatcccttgaagttcaaatcacaaaggagctggaggacgttgaagttgatgaagga
gaaccagcaactttggagatctgttttgtgagtcgagacaaaccagctgtgtcctggttc
aagggaatgaagcctgtagaaccgaacaagagagtcaaaattataacagatgagcaaagc
agtaagctgattatcaagaagaccgtcggtgaagatgagggactttacaagtgttcagtt
aaaagtgggacttgggaaatgaattcctctgcagaacttatagtggaagaaccaagtgac
gacgaaaaagtgatactcaggaagcctgttctggttcaaaaattttctgatggggacatt
gtggagggggaaaagcttgaactgcagatcaaagtgattggctccaaacctgtcactgtc
acgtggtacagagacgatgaaaagatagaagcagacgatcactgcaaattactctcagac
gacgagattcatgtgctcagagtaaaccaagcagaaatcgacgacgaggccatatacaag
tgtgtagtgaagaatcctgcaggacaagatcagtgtgaggcacaaatcctggttgaagaa
aagactgattctgtggaatttgttgatgcagagttcagtgaaaacgctcctcatttcatc
tcacgtttgccagaagagatagaggttcttgaaggtgacttaacacggcttgaatgtcga
ataggacttgcggcagaagtttcctggtttaaagatgacgaacctttggaggaggacgat
cgcatcaccattgaaaacgagggtgatgcttctgcagttgtcatctcctgtacagaatta
gacgatgaaggtgactacaaatgtgtagtgcaaaacgagtttggtagagccatgtgtcag
actgaggtaattgtggaagaaggtgttagtatgccactgattaaggagtcgctgaagaac
cttgaggccaatgaaggtgatgtggttaagtttgaggttcgtatcacaggtaaccctgaa
ccggtggtggaatggttcaagaacgggagtcagttgcaagacgagggacgtgtgatcatt
gttgacgatgctgatgacaatgacgaagagctcttttgtctcgtcattgaggattgtaaa
gttggtgattctgggacgtacaaggtcgtggcaatgagtgaggctggaactgccaattgt
gagtgcagcctgaatgttactcgtactcaggttccgccggagttcaaagatgaaatggaa
gaggtgcctatggaaggctctcaaggcgacaatgtgtctatggttgtgaatactggtcgg
ttaccctcaccagtaattgcatggttcaaggacgaagagccagtcgtgtccagttctcat
cttgagatctcacatgaccccgatcactctaagctaatggttcatcatgtcaccccagaa
gactccggtacttacaagtgtgttgcaactagtgtaatgggtacaattaccaagaagttt
cttcttaatatagaaggatcagaacctaaattagaacagacaataagtacttccgacttg
caagcagaacctgtaagagatgttgccgcaccggtgttcctaaaaaagatggatgctgtt
gtaattaatgctggagaggaggcccgatttgatgttagagtttctggcgttccagaacct
aaagttgtatggtatcgggggtcaaatgaggtgaaagatgaaggacgatttgtgcacatt
gatgccattgaagaagatctgttcacattggttattgaaagcagtgaatcaggagatgct
ggtcaatacaagtgcgttgcttccaacgaagctggtcaaacgtcatgtgaagctcagttg
attgtacgcgaaaaggaagttgacaaaaaacctctcaatgaaaatgttcaagctaaacca
cgagaagaggcccccaacttctcacagccactgcagacagttgaggtcatagaaggaact
gaagccactcttaagtgtatggtcacaggcaatccagagcctaacatagcttggtttaaa
aatggtgacactgtggcagaggagaaaagatacaaaactcgatataatggagagcaagcc
actttaaaaatccagaatacagaattggatgatgagggtgaatacaagtgcgttgctgaa
aatcacctcggttcagcctcttgttccgctgaactccttgttaatgaaccaaacactatg
cctgagtttgaagaaaaaatgaaaccagttgatgtcattgaaggagaacttgcaaaattt
tctgtgaaagtggctggtaatccacctcctgttatagactggtttaagggaaaagataaa
ttagaggacgaagggcgaattgaaataattgatgacgaagacagtggtaattacacactt
ataatcaatgacacgctcttaggggatgctgggacatacaagtgcatagctttgaatgaa
gaaggtgaaaggtcatgcaaagccgccttggcagtaaaggaagctgttactaaacctgaa
atagtaattgaaccagaagcgactccgttgaaagtagcagagggtgatgttgtcagtctt
agtgcgatcgtgaaaggaaaacctgttcccacagtcgactggtacaaagatgatgagaag
ctgcgggaaacaagccgtttgaagatagatgccaaagatggcgaacactctcttcttatt
ctggaagccaaacctgaggactctggggtgtacaagtgtcaggcaaagagcaaaggtggt
aacgtggaaaaaacctatcatgtcgacataaaagccgcaccgcccgaaggtattgcacca
gtattcatagagtccctacagacagtagaggtagtgcaggggtcacccgccaagctacag
tgtagagttactagcaaaccagaaccaactatcgactggttcagagacaacgaaccggtg
aaggaagacaagaggatcaagatccgttttgacggcgaattgtgcactttgaagatctta
gaaactgagcttgaagatgagggcgcttacaaatgctttgcaaagaatgaatttggatct
gtttcctgcacttcggaacttctagttaacgaaccatacaagaaaccggagttcacacag
agaatgaaacccgttaatgtcactgaaggagaggcagcacggtttgatgtcactgtggaa
ggaaatccaattccagtggtggattggttccgtggcaaagacaaactggaagacgatggt
cgttacgtgatgatgaatgacgaagaggcaggcatctccacactgatcatcgaggacact
cttcttgaagatgcaggaacgtacaaatgcatagctgcgaacgaggaaggacaggcaagt
tgtaaagctgctcttgctgtcaaagagaaaatgatgacaccagagttcacggacgaagaa
caaagccttccatttaactttatggaaggagatgaggcacgcttaactgtaggtataaaa
ggcaagcctgtaccaactgtggagtggtacaaagatgacaaaaaggtaagaaaaaccagc
agaataagaatggacgaaaaggatggcaagttctctttggtgattttagatgttacttct
gaagacaagggaagctacagatgtgaggcctcaagcaaagcaggcactgtcactcgtaga
tttgatgtaaacgtagcagaaaagagcccggaaggaaaagcaccggaaattgtggaacct
ttaaagtttgttcaggtccttgaaggttctcctgccgagttaaaatgccaaataagcgga
cagcccaagccaacggtggagtggcttagaggcaacgagaaagtgaaggagtccgagcgt
atacagtttgtaagtaataatgaaaccttctctctgaatttcaaggaagccgaacttgac
gatgaaggtgactacaaatgtgttgcccagaatgagtttggcagtgtgtcttgctgggct
gaatttcttgtaaacaaaccagctgcaaaaccggagttcagggagaaaatgaagcatgtc
actgtccaggttggtcaacaagccaggtttgatgtgcttattacgggagtacccaagcca
caagttgattggatgaaagacggtaagatattggaagaaccagctgagagatttactttt
ctggatgatgaggacgaggaagatgaagggcgctcctcacttaccattgaggacgtaaaa
ctagaagatgctggaaaatacggatgtcttgctttcaatgaagaaggtgaagtattctgc
gaggccaaccttttagtgcaagagaccctgattgcccctgcgtttgttgacgaagctgaa
agtgccccaattcttgctgaagagggaggtgaaatcaatttgagtgcagaactgaggaaa
agccaaccagaactgaaagttgaatggctcaaagatgacaaaacaatcaaagaggatcaa
cgtttgaatcgttttgtcatagaggacacacacatgctgaaaattacgggggttgtccca
gaagattctgggttgtacaagcttaaggctagtggcaaagcaggctctgtagagagggag
tttgatgtacaaatttcagccaagcagccagagggtgatgaaccacaatttacagagccc
ttacaagcagtagaagtgaaagagggcgatgcgactaaacttcattgtacagttaccgct
gaaccacctccgacctttgagtggctaaaagatggagttcgagtgaaagagagcagaaga
gttaaagtggatagtgatgggatgacatcctctctctcttttaaagacgcgaggccagat
gacaaaggagaatacaaatgtgttgcctctaacgcattcggttctgcttcgtgcgcagca
gcgttgaaagtgatggttctatctaaaccagactttaaagagaaattgggaggggttgaa
gtagttgagggtgattgtgccagctttgacgttgttgtagtcggttatcctgaaccgttt
gttgagtggtacagagggaccataaaactacagaatgacgagcgcactgagatcaaagag
gttaaggatcttgcccgtttttctcttaccattaaggatgttagtcgtgatgatgctggg
atctataaatgcgtggcctccaatgaagctggaaagaccacagtacgtggtgagctctct
gtgaaggagaggctgtttgctcctgaaattcctgaaggacaggaagaggcccccattaca
gttacagaaggcgatgactgtaatttgaatacaacgatcgttgggaagccgaaacctgac
gtgaaatggtacaaagacgataaaccccttcgcgagagtacaaggcttgacatcaaagcg
cgtggagataaacactctgtagtgattcttggcatccagacgaatgactctggtgtttat
aagtgtgaagctaagagtaagatgggaactgcaaccagaaagtttgatgtcagagtacga
gccgagaaaccgaaaggaatagcaccagaaatcttaacacccctccaaaaccttacagtt
gtggaaggtaaaccagcaaacttggagtgtgaggtaaaaggagaaccacaacccaatatt
gaatggtttaaagatggcgagcaagtgaaacagtcggagcgcatcaacttgaactttgaa
ggcaattttgcttctttatcgttcaaaccagctgagcttgacgatgagggtgagtacaag
tgcgtggctcgtaacgagctcggcagtgcgtcaagcgaagcagagcttctggtggaagaa
gctgaaaccaaaccagactttaaagaagagctgaagaatatcagtgtcttgccaagggcc
gaagccaggtttgatgtgcgtgttgtgggtgtaccgccaccagaagttgactggtttaag
ggaaaacaaaagatcgaagatgagggtcgctttattttgattgatgacgaagaggacgac
ctgttttctttagtgattgaagaggcaaggccaagtgacagcggtgaatatgagtgtgtt
gcattcaatgaagtcggtgaagtttcatgtaaaagtaaattaattgttggagaaacgctg
atcccacgagaagaggctgaaagtgcgctgcctgcggttgaagaatccatcactgtaccc
gagtcagctgccaaggtcgagagcgctcttgttatggaacaggaaggaggggatgtgaaa
gctaagaaaccaggaggaaaagcaccggtattttctgaatctcttcaatccgtggaggta
aaggaaggaagtgatgccaaactacagtgcactgtgactgctgaacccaaacctaacatc
gagtggtttaaaaagggagtgcggatgaaggaaaacagacgggtcaagtttgaaagtgat
agtgactcctttgctgtaacaattagggatgccagatcttttgatgaaggagaatacaag
tgcgtggctaccaatgagattgactcagcatcctgtgcggccactctaacagtgcgagtc
gtagctaagccagaattcaaggacaaactcaaaagagtcgaagtgatggaaggagactct
gcgcaatttgatactcgagtagttggttaccctgtgcctgagctacagtggtttaaaggg
attagtaagctgaagagcgaaggtcgaattgagtttaaagagaattctgaagacaatatg
ttttcacttgaaatccgtgatacccagcgtgacgatgctgggatgtacaagtgtgaagcc
tcaaacgaagggggtaaaaccacatgccgagcggacctcatagtaaaggagaggcttttc
gcccccgaaatttcaggagaccaatctgaggctccccttactgtgactgaaggcggagaa
gttagtttggatgtcacaatcaacggaaaaccaaaacctgacgtgaaatggtataaagat
gacaaaccccttcgcgagagtaccagactagacattagagcacgtggagataaacactct
gtggtgattcttggcatcagggcggatgactccggtgtttacaagtgtgaagctaagagt
aagatgggaactgccaccagaacgtttgatgtcagggtacaagctgagaggcctaaagga
agtgccccagagtttacctttcctttgcaatcagttgaagcatccgaagggaccaaagtg
aaactttcctgtactctgaaggggactccgcaaccaaccatccagtggcttaaagatgga
gaaccattagagaccaacaaaggagttacagctgactttgatggagaacttgcttctttg
tcatttagtgcagcggaacttgacgatgagggtgattacaaatgtattgctcaaaatgag
ctgggtgctgcatcctgctctgcagaacttctcgtaaacgaagctgatagtaaaccagaa
tttaccgaagctatgaaggacatcgaagtagctgaaaacaaagaaggaaggtttgatgtg
cgtgtaacaggatatcctaaaccagctgtgcaatggcttaaaggagctgacaagatcgaa
gatgctggaaaatatattttaattgacgatgaggaagatgatctcttctctcttgtaatt
gacgatgtttccccagatgaagccggtacttacacctgcaaagtaactaataacgttgga
gaggccgtctgcgaagctgaacttaaactaaaggagagtatagcggcccctgaatttgct
gacgaggaggagacaggcccaatcacagcagttgaaggtggcgaggtgacattgtctgtt
gccgtaaaaggcaaacctcgtcctgatgtcgagtggttcaaaaatgataagccactgaaa
aaaacaagtcgtctggacgtaagatcccgagacgacaagttctctttagttgttatgaat
gtctcaccagaggactctggcctttacaagtgtgtggctagcagcagggttggacgcgtt
attagaacattccaagtgaatatcgaaggaaaaaaagcaaagaaacctaaaggagtggca
ccacaagttacacagcctttaaaagcaacgcagattgtagagggaaatcctgtaagactg
aaatgtcgcatgactggatcaccagaacccacggcagagtggttaaaaaatggagaacaa
gtcgaacttagtcaaaggatcaaagctgatgtaataggcgatatgtgtcaattgtccttc
gctgaaacgcaagaagacgatagtggatcttacaaatgtgtcattataaacgatctaggg
tcgactttttcagaagcagaacttgtcgtgaccataccaattgtagcacccaaatttaag
gaaaagctaaaaggtttacaggtgaatgaaggcgaacaagttcagcttgatgtacgggtt
agcggaaatcctacaccgaacgtttcttggttccgtggacctcaagctatcattaacgaa
gggcgatttattgttaaagcagacgacggggatgaattatattctctaataattgatgaa
acaactttagatgacagtggtacttacaaatgtgttgcgtctaacgaggcaggaaaagcc
acatgtcgtggggaattagaagttaatgaaaagcttacggctccagaatttgcaggcgtg
ttcagtgacgctccagttatcttcagagaaggggaagaagtttcgatggaagttacaata
cgaggaaaacctgctcctgacgttgagtggtataaagatgaacttagtgtcagaaagtca
tcaaatatgaccaccctggtcaaaggagagaaacaaacacttctcatttacaacgccaag
ccagctgattctggagtgtataaatgtgtggcaaagagtaacatgggaacagcaatgcgg
acgtttaacatcaccgtagaagccaaaaaacccaaaggctcagcgccggagtttttcaag
cctctaaagaaaatagaagttgttgaaggcagtagtgctaaattagagggctgggttcat
ggaaagccagaaccaagtatcgaatggtacaaagacgatgaacttgtcacatctaataga
cgagtgaaaacctacttcgactcggaagtttgcagactgacaatttctgatactgttgct
gatgacgaaggggaatataaatgtgtagcaaccaatgaacttggcagtgtgtcgtgctcc
gcagagctgcttgtaaatgaagctattataataccagagtttgaggagaaattgaagcac
actgaagttattgagggtgataccgcgcgatttgatgtctgcgtggttggcaatcctaag
cctgttaccgaatggtcaaagggtggaaaagctatcgtcagtggaggaaggtttaaaatt
gtgtattctgaggacagcaatgtacattccttatttattgagaatgtgtcattagatgac
ttcggaagctataaatgcgttgcgtctaacgaagctggaagaatgcaatgttctgcacgg
cttgatgtaaaagagagacagattgcgccagagttctccgatgaatacggtgattcacca
atagaagttaaggaaggcgatgaacttaagataaacgtgacaattcgggggaatccaagt
ccagacgcagaatggtttaaagatgacaagccatttaaaagaacaagtcgcggaaatata
tcagcgcgaggaaataaatttggtatcacaatcttcactgttactcccgaggactctgga
gtatataaatgtgttgcgaagagtgctgcaggtacaacgactaaaaccttccaggttgat
atcgaaggcaagaaacctgcacccagattcactcaaccgttggaagagactcaagctacc
atcggagggacagcgagactgaaatgtcgcctaaatgccacagccaaacctaatattgaa
tggaaaaagaatggtcaacctgttagtgaaaaccgacgggtgaaaacagagttggagggt
gaactcatctcactggtcatctcggacgctaggtttgaagatagcggagaataccagtgt
gttgttaagaataagagtggaactgcgtcttgtagtacgcgtctttttgtgagcgaatcg
acgagtaaaccagagttcaaaaaagtgatgaatgatctggaattactagaaggagatgac
gccgtttttgagattgcagttaatgccaagcccgaccccaaggtgcaatggttcttgaga
aaaatgcccatcaagagtgaaggaaagtacaccatcgatgaagactcagagcggcagagg
ttttcactcactataagcgattgccacacagaggacagtggtcagtatcggtgccttgta
acaaacagcgctggtgaagtcgcgagttcagctgagctcaaagtcagtgatagacaagtg
gcacccagatttattcaaggcacagaggagcagctgtttgaggtttgggaaggagctcct
gtcaagcttgtggtgcaagccagagggaagcccacccctcaagtggaatggtttaaggag
aatcgcctggctcggagagtcaagcgagttgagctggagaccgaagatgaccagagcatt
ctgttgattcccaaggcagtcccagatgattcagggaattaccgagttgaagccacgaac
tccgctggaacagctgtcaaaccatttgttgttaaagtcaatgctcaaaagcttgttctt
agacgagaaccagttcctgccggagctgtaaaaccagaattcattcagcgacttcaggac
gttgagatcgttgaagggagtgctgctaagtttgatgtccgtgtcaaagggacacccgag
ccggaggtggactggtacaaagacaaccgtgtgatacgtgaaggcggtcgaatgagattc
ttgtttgaagacgacggtttgtgttcactgctcataagagaggctgaatcatctgaccga
gggcgttacaagtgcgtggcgagtaatccagccggcaaagttcagtgcagtgcagaacta
ttcatagagagccatggttttgattctaccagtggctctgatcacgagagacgtctttca
cgagagtcaacttttgatatgctgtcggacgacacagaagatgaagttgaatcatcctcc
tcaagtggtccacctaagcttcctccagacataacgcttgtgttacgcaaccgtgacgtg
aaggagggtggcgtgacaaagtttgcttgtcgagtggttagcagtagtagcgtgactgct
gagtggtacaaagatgatcagcttgtcaataaatggccccgcttcacttgtgaacgtgat
gaggatctttatgctttgaacatcacagacgccaagaggacagatgcaggacacattcga
tttgtggcacggaacgagtttggtcaggttgagagcaatgcatacctcaatgttgaacct
gacatggaacctgaattcgaaggaaacacaccaaggtttattcagaaacttaaagatgtt
gatgcagtgcccggtaaaacggcgagactggagtgccgtgtgatcggcgacccgcggccg
gatatccgatggtacagagagaacgaacccttgctcgagggagggaggtacaagtttgag
gatgatgatgacagacaagtgcttgtcatagatgacgtgtgcggaagtgacgaaggcatg
tacaagtgcgtggcaaggaacagcgccggcaaggctcactgctcagcagatttgtatata
ttacaaacagatgacgaagagagcgaatcagctggtgaacaagaactagaggaagagaaa
cgaaaacaacgtgtttctacggaagcatcaccagtgattgagaccctcatctcgcctgat
tcagctcaggtagagaagtcagaaccacccttgccaacaactctaaagacacaatccaaa
ccggagcctccaaaaccaaaagaacgtctccgacaaccagaatttattctaaagcttcga
gataagtcagcggttgaaggcagctcagttcgcttggcatgtcgggccatgggaacaccg
gaacctggattccagtggtacaaggatggcgaaccaattagcgcaggaggacggtttgac
atcaaccaatcagtgagcggatttacgcttgtgatcaaagaatgtcagttggaagactcc
ggtgaatatcaatgtgaagccacaaacaaagtaagcagcgtcagcacctccgctaaagtc
actattacagcactctccaaacctcgtcaagaagtaacggttagtccaaaatttgaacag
aatttcactgagacaaaaatcactgagggagaggacattaaactgacagctaaggtgtcg
ggtaatccagtcccagatgtgatatggcagaagggaggcaagccaatcagagaaggccgt
cgaattaagattgacaagagcaaaaatggggtgcattcacttcgtataccccgtgcacag
gctgatgatggaggagagtacacgtgcatagcaagaaacaaggcaggggaggcttcatgt
tctgctaagcttactgttgaagctcccaagccagaaatcaaggagggtgttatgtcactt
cctaagaagccagttgacgaggacattgtagtaatggccacagacattccagtgtcgcgt
gaacgtgagcttgagagtggtactcctgcgacccctcctaagtttgatcagacgatgcag
acagcagaagttgtagaaggaagcgcggcgcgatttgatgtcacggtcactggaagccct
gtcccgaaagtacgctggctaaaggatgacaaactgcttgaggagaaccgaaaaatccgg
tttgatgaggatgacgacggagtgttctccctatttgttaatgatgttgttgtagacgat
gagggtgtgtacaagtgtgaagcaacaaatgtcaaaggagaagtgacctgcagcgcagag
ctaatagtagaaggccttgaagaatcaacaggagatgagagtgaggaaacttcggaagat
gagttacagtccaaggaagaacttccaataaaggaggcgccgaaacctactgacaagaaa
gtggcgcccccacctgcaccaaaaccaaagcctgcagttaaatcagttccaaaaccggtt
ttctcatcagagcttcaagacaaacaggttaaagaaggagacaatctgacgctagacgtt
cgagtaccactcgagtgcaaagccgaggtcacgtggtacaaagacgaccacgctctgaaa
gaggaccatcatattgccattatctccgctggagagatgcaagcagttaacatcttcgat
gtgtcagtcaaagatgaggcggtctaccgttgtgttgccgccaatgatgatggatcagtt
tctactgattgtgaagtgcttgttgaagagaaagtcaaagttccccaaacagtaatgaac
cgcggtcgcctttcccaaatggcgcccgaatttgttcaagaatgtagcgacctgtgtgtg
gtaaagaattccactgcacaactagaaataatagccgctggcagccaaccactgcagatt
cgatggtttaaagacaacgagccgatcaagtatggaaagcggttgaagttgtcgtctgat
ggagaacattgctcgctcaagatttctcctattgagattcaggatcaaggaatttacaag
tgtgttatatctaataaggctggaacccagtcctgcgaggccaagttaacagtgggagaa
tcggtagactttaaagaaagtaccgatggcacagccccaggttccccagtggcaaagcgg
ccatccaggtcaaagagtggtgctaaaccgactattgtctctccactggaggatattgaa
gttaatgatggagaaaatgtcactttagaggtgacttccggtcctgaacccattgacaac
atcgagtggttcaaagacaatgacctcatccgctctcagcctcggttcactcagtcatca
gcgggcgagcaacacaccttggacattcagtcagtcactgtcgatgacgaaggaatttat
aaatgtgtgctgctcaatagctggggcattgcttcgtgttcggctgaagtcctagtggaa
gaatcaatgtcagaatcttcatcccaagatgacgaacaacttgaaaagtttaacgcccgt
atggaacgtcggagatcacgtgacagtgtctgcgagccagaattccaacaagagcttagc
aacagcgatgtctttgttggggatactgtatactttactgtcaagtcaaggggcataccg
gaaccgaaagtctcatggtacaggaacggagagctcgtgaaggaagactctcgagtgaag
tttatcaaagattcgcagagtggaaactattcccttcttatcaacaaagtgaccgtggag
gacgagggcgagtatcgttgtgtggcttccaacatggggggatctgttgcctgtcaagca
aaacttttggttaaagggcataatcaagatgaagcgccttcattcacagcgccgctgacc
gatcgctctatcgaagatagcagtgcagctaggtttgatgtgcgtgtgcgcggaaaacct
gctccaacagtctcttggtataaagacggaaaagagatcagtgatgaacagtttccacac
atcaaagttttgcaggaggaagacttgttctctattctgataacagaaggcaagtttgaa
gatgctggaacgtataaagtggtcgccaaaaacgttctgggagaagtgtcttctactgga
atgttatttgttgaaggagccgatcagctgccaccctttgctggaggaaaacctccgcgt
aagaactcaggcctctcaagagttgaagaggttctgacgctcaagctgtacacagccatt
gaggacttctattcggaagagactggaaacaaatttcttaagaggggcgacaaagttgaa
gtactagatacaagccgacctgagttctggctggtcagacgagtgtcacgtgggtcagag
attggatttgtacgtcacacatgcctgaaaagagacgaagacggggatgaaaccacagac
gcaccggtgataggagagaaacaaaagtttgtatgtatcaccaactacacggcccagtcc
cccgatgaggtctcggtaaatgagggtgacatgttagagatccttgacgacgtaggcatg
gagaactcgatggtctgcgttattcctaccggcgccgtcgggtggttaccaagggtcttt
atcataagggcccctgaagaggatgtgaagaaggccccaaagactgctaaagggaaagag
agggaagcacttaatcagcgagaattcgtgcttaacgaattgatagaatctgaaaggcag
tatgttaacgaccttcgaactgttgttgagagtcacctagctgaacttgatgctgctgat
attcctgaagaagttgttgaacatgaggatgttgtgttttccaatatcaaggaaatatac
ggatttcacacaagactattcttgcacgaactggaggcttgtgcaaagagtccagatgac
gttccaaaggttattgtacgacacaaaccaaaatttgaaatgtacatcaagttcctcgag
ggaaggccgctggcaaacgaaaagctggagagtgagaaaacgcaagagttttggacggag
ttccaagaagacacgaaagatgccatctctctctcagagtaccttaaaaaaccagcacag
cgccttgatgaatacgtcctgcatcttaaggaattgctcaagttcactgtacgtgcgaat
ctgcagcattcggattttcagacggctcttgaattcctagccagtctatcccgacgagga
aatgaagcagcacaaaaattccacatcgaaggatataatggtgaggttcctcttgaaaat
ctagggagactaatccgccaggaggtggtcttattctgggaagagaaagctcgaggaaaa
ggaaaagaacgggacttgttcttgttcgagaaaggaatcgtcaacacgaaaagaaaagaa
ggaggaagaaaattcatctttaaaaacatgctgaagctgacaagtggtaatgttggtctg
actgaacatgttgaaggaggtgcccgtcagttcatggtgtgggtgggtacctccatggcc
actgctcttgtacttcacacatttgagacgaagaccgagtggtccaaacaggtctgggtt
cgtgaaatcaaaaggctgttacatctgagtgaaaaatcattaaacactgctgttacacca
tctctggtgtttggtgaacttgaagttcaattgccaagtacttcagccacagaagggaac
ctggtgaccacagtcaaagaaactatcactagtccctcttactcgcgtttgatcgctgag
ctcgaaaaacagtatgtggccatcacaccaccggactcacctgaacctcaaagcctgaac
attcaactaggaggcacctaccacttgtcggaagaaacactggaacgagatacacgcgag
cgcgtaatcggccgcggtgaacaagtacgagtgctccgctcaggccgagatctctacttc
gtgcaaaccgtcaaagatggagaaaccaaagagggctgggttcctggaagctggttgcta
gaaagaggttttgacgaccagattacaggcgcccaagtccaggttgagctggaagctggt
ttagaagatgatattgcacaagatttgagttcagaagcgtctgaaccggagctgcaacgg
ctcaaagaaactggggaaggtaaatag

DBGET integrated database retrieval system