KEGG   Pocillopora damicornis (lace coral): 113679200Help
Entry
113679200         CDS       T05773                                 

Definition
(RefSeq) dihydrofolate reductase-like
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00670  One carbon pool by folate
pdam00790  Folate biosynthesis
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    113679200
   00670 One carbon pool by folate
    113679200
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     113679200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1 Kelch_2
Motif
Other DBs
NCBI-GeneID: 113679200
NCBI-ProteinID: XP_027051953
Position
Unknown
AA seq 186 aa AA seqDB search
MTTQRKFSCVVAVAEGGGIGKNNTLPWRLKADLKFFSKLTSGVPTEGKQNAVIMGRKTWE
SIPAKYRPLPHRMNILLSKTLSVAPTGATLCSSLQGAFDLLSTAQHIDKVEKIFVIGGAA
VYKEALQHPAAHRLYITHVLKDFDCDVHFPEFDKTVFRETSDPDVPSGVHEDNGIKYEFK
VYQRDI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagcgaaagttttcttgtgtagttgctgtggcggagggtggaggaattgga
aaaaataacacgcttccctggcgtctgaaagcagatttgaagtttttctccaaactcact
tctggagtgcccactgaagggaagcaaaatgccgttatcatgggccgcaagacgtgggaa
tccattccagccaaatacagaccccttccccacagaatgaacattttgttgagtaaaacc
ttgagtgtagctcctacaggtgccaccctttgttccagcctgcagggtgcctttgatctg
ttgtcaactgcacaacacatagacaaagtggagaaaatctttgtgattgggggagcagca
gtttacaaggaagcactccagcatcctgctgctcaccgcttgtacattacccatgtgttg
aaagattttgactgtgatgtacatttcccagaatttgacaaaactgtatttagggaaaca
agtgatccagatgtgccaagtggtgttcatgaagataatggaatcaaatatgagtttaaa
gtataccagcgagatatctaa

DBGET integrated database retrieval system