KEGG   Pocillopora damicornis (lace coral): 113679819Help
Entry
113679819         CDS       T05773                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam03040  Spliceosome
pdam04141  Protein processing in endoplasmic reticulum
pdam04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113679819
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113679819
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113679819
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdam01009]
    113679819
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pdam03041]
    113679819
   03009 Ribosome biogenesis [BR:pdam03009]
    113679819
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113679819
   04131 Membrane trafficking [BR:pdam04131]
    113679819
   03051 Proteasome [BR:pdam03051]
    113679819
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113679819
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113679819
Protein phosphatases and associated proteins [BR:pdam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113679819
Spliceosome [BR:pdam03041]
 Complex B
  Other components
   Prp19 complex
    113679819
 Complex C
   Prp19-CDC5 complex
    113679819
Ribosome biogenesis [BR:pdam03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113679819
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP70 / DNAK
   113679819
Membrane trafficking [BR:pdam04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113679819
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113679819
Proteasome [BR:pdam03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113679819
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113679819
Exosome [BR:pdam04147]
 Exosomal proteins
  Proteins found in most exosomes
   113679819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 113679819
NCBI-ProteinID: XP_027052591
Position
Unknown
AA seq 656 aa AA seqDB search
MPGTPAIGIDLGTTYSCVGVMQHGKVEIIANDQGNRTTPSYVAFTENERLIGDAAKNQVA
LNPTNTVFDAKRLIGRKYDEESVRSDQKHWPFAVINDGGRPKIQVEYKGEKKSFFAEEIS
SMVLTKMKETAEAYLGSKVTDAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDKNAAKNTERHVLIFDLGGGTFDVSVLTIDDGIFEVKSTCGDTHLGGEDFDNRMV
DYFKKEFQKKYKKDISGNKRAMRRLRTSCERAKRTLSSSHQANIEIDSLYEGIDFYEPFS
RAKFEKENGDLFRATLTPVEKALKDAKLTKEKIDEIVLVGGSTRIPKIQELLKDYFDGKE
LNKSINPDEAVAYGAAVQAAILHGDKSEAVSDLLLLDVAPLSLGIETAGGVMTALIQRNT
TIPTKKSQVFTTYADNQPAVLIQVYEGERSMTKDNHPLGKFELTGIPPAPRGVPQIEVTF
DVDANGIMNVSAVDKSTGKENKIVITNDKGRLSKEDIERMVKEAEKFKDDDDKQRDKIQA
KNSLESYAYNMKSTIEDDKVKDKISEDDKTVISDKCKEVIDWLDQSDGASKEEFESKQKE
LEKVCNPIITKLYQGAGGAPGGMPGGGMPGGPGGFPGGPGATQQGESSGPTIEEVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaccccagctataggaatcgatcttggtactacgtactcgtgcgttggtgta
atgcaacatggaaaggttgaaattatcgctaatgatcagggtaacagaacaactcctagt
tacgtcgctttcaccgaaaatgaaagactcatcggagatgcggcgaagaatcaagtcgcc
ctcaaccccacgaatacagtgttcgacgcgaagcgtctaatcggccgaaagtatgacgag
gagtctgtcagatcggaccagaaacactggcctttcgcggtaatcaatgatggtggtcga
ccaaagattcaagtcgaatacaaaggcgagaaaaagtccttctttgcggaagagatttcc
tccatggttctgaccaaaatgaaggaaactgcagaggcttatcttgggtccaaagtcacc
gatgcagttgtcactgttccggcatatttcaatgactcgcagagacaagccacgaaggat
gccggagtcattgctggccttaatgttcttcgcataatcaatgagccaactgctgccgcc
attgcctatggtttggacaagaatgctgccaaaaacacagagcgtcatgttctcatcttt
gatcttggtggaggtacctttgatgtgtctgttcttacaattgatgatggcatctttgaa
gtgaagtcaacctgtggtgatacccatttgggaggtgaggactttgacaatcgtatggtt
gattacttcaagaaagaattccagaagaaatataagaaagatatctcgggcaacaagcga
gccatgcgacggttgagaacttcttgtgaaagagccaagaggaccctctcttcaagtcat
caggccaatattgaaatagactctctttatgagggcatcgatttctatgagccattcagc
cgtgcaaagtttgaaaaagaaaatggagaccttttccgcgcaactttgactcctgttgag
aaggctctgaaagatgcaaagttgacaaaggaaaaaattgatgagattgtcttggtgggt
ggctctactcgcattcccaaaatccaagagttactcaaagattactttgatggcaaagag
ttaaacaagagcattaaccctgatgaagctgtagcttatggtgcagcagtacaggcagcc
atcttgcatggagacaagagtgaagctgtgtcagacctgctgcttctggatgtggctccc
ttgtctctgggtattgagactgctggaggtgttatgacagcactcatccaacgcaacaca
acaatcccaacaaagaaaagtcaagtcttcacaacatatgcagacaaccaacctgctgtt
ttgatccaagtgtatgaaggtgaacgtagtatgaccaaagacaatcatccactcggaaag
tttgagctcactggcattcctcctgctcctcgtggtgttccgcaaattgaggtcacattt
gatgttgatgccaatggaattatgaatgtttctgcggtggacaaaagcactggaaaagaa
aacaagattgtcatcacaaatgacaaaggtagattgtccaaagaagacatagagcgcatg
gtgaaagaggctgagaagtttaaagacgatgatgacaagcagcgcgacaaaattcaagcc
aagaactctctggagagttatgcttacaacatgaagagtacaattgaagatgacaaagtt
aaagacaagatcagtgaagatgacaaaacggttatctccgataaatgcaaagaagtcatt
gactggttggatcaaagtgatggagcctcaaaggaagagtttgagagcaagcagaaggag
cttgagaaggtgtgcaatcctatcataaccaagctctaccagggtgcaggtggagcacct
ggtggaatgcctggaggtggaatgcctggaggaccaggtggcttccctggaggaccaggt
gccacacagcaaggagaatcctcaggtcctaccattgaggaagtagattaa

DBGET integrated database retrieval system