KEGG   Pocillopora damicornis (lace coral): 113680780
Entry
113680780         CDS       T05773                                 

Definition
(RefSeq) retinal dehydrogenase 1-like isoform X1
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113680780
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     113680780
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 113680780
NCBI-ProteinID: XP_027053628
Position
Unknown
AA seq 492 aa
MPQAVRNPEIKFTKLFINNEYVDSVSKKTFATIDPVTEEKICEVAEGEKADVDKAVKAAM
EAFKLGSPWRTMDASQRGKLLYKVADLIERDLDYLASLETRDSGKLFTDSVDDMDLTVKC
FRYYAGWADKITGKTISSDGPYFVYTRHEPVGVVGAIVPWNFPLNMACLKLAPALACGNV
VVLKPAEQTPLTALYVGSLFKEAEFPPGVVNIISGYGPTAGAAISEHMEVNKVSFTGSTE
VGRIIQAAAAKSNLKRVTLELGGKSPNIVFADSDVDYAVEQAHSALFFNQGQCCSAGSRT
FVQDTIYDEFVKKSVERAKKRSVGDPFDDVIEQGPQVDGEQFNKILDLIESGKKEGAKLE
CGGARHGDKGYFIQPTVFSDVKDHMRIAKEEIFGPVQQIIKFSDINEVIERANKTTYGLA
AAVFTKDIDKATTISHSLQAGTVWVNCYECGAPQAPFGGFKMSGFGREWGEYGLLPYLEV
KTVTMKVPSKNS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcctcaagctgtaaggaatccagaaattaagttcacaaagctttttatcaataatgaa
tatgtggactcagtcagcaagaaaacttttgctactatcgatccagtgacggaggaaaag
atatgtgaggttgcagagggtgagaaggcagatgtagacaaagcagtcaaagcagccatg
gaagcttttaaacttggtagtccttggaggactatggatgcttctcagcgaggaaaattg
ctgtacaaggttgctgatcttatagaaagagatctggactatctagcttccctggaaaca
agagatagtggaaaattattcactgattcagtagatgacatggatctaactgtgaagtgc
ttcagatactatgctgggtgggctgataagataacaggaaagacaatctcttctgatggt
ccttactttgtgtacaccagacatgaacctgtgggtgtggttggagctattgtaccatgg
aatttccctcttaacatggcttgcttgaagcttgctcccgctctggcttgtggcaatgtt
gttgtacttaaaccagctgagcaaactccattaacagcgctgtatgtggggtcattgttt
aaagaggctgagtttcctcctggtgttgtgaatatcatctctggttatggtccaacagca
ggagcggccatatctgaacatatggaagtcaacaaagtttcatttacagggtcaactgag
gtgggaaggattatacaagctgctgcagcaaagtccaacttaaagcgtgtgacactggaa
cttggaggaaagagcccaaatatagtttttgctgatagtgatgtggattatgcagtggaa
caggcacactcagcattgttctttaaccaaggacagtgctgcagtgctggcagccgcact
tttgtgcaagacaccatttatgatgagtttgtgaaaaagagtgtggaaagagctaaaaaa
cgttcagttggggatccatttgatgatgtgattgagcaaggaccacaggttgatggagaa
cagttcaataaaatccttgatctgattgagagtggaaaaaaagaaggagcaaagcttgag
tgtggaggtgctcgacatggagacaaaggatattttatacaacccacagtcttctcagat
gttaaagatcacatgaggattgccaaagaagagatatttggtcctgtacaacagatcatc
aaattcagtgatataaatgaagttattgagagggcaaataaaaccacatatggcctggct
gctgctgtatttaccaaagatatagacaaagcaacaacaatttctcacagcttacaagct
ggaacagtttgggtcaactgctatgaatgtggggccccacaagctccttttggaggcttc
aaaatgtctggatttggcagagaatggggtgaatatggtctcctgccctacctagaagtg
aaaacggttacaatgaaagtaccatccaagaattcatag

KEGG   Pocillopora damicornis (lace coral): 113680782
Entry
113680782         CDS       T05773                                 

Definition
(RefSeq) retinal dehydrogenase 1-like
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113680782
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     113680782
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 113680782
NCBI-ProteinID: XP_027053634
Position
Unknown
AA seq 422 aa
MDASKRGQLLYKMADLIERDLDYLASLETIDSGKLFADSVDDMEFTVKCFRYYAGWADKI
TGKTISSDGPYFVYTRHEPVGVVGAIVPWNFPLNIACLKLSAALACGNVVIVKPAEQTPL
TALYVGSLFKEAGFPPGVVNIISGYGPTAGAAISEHMDINKVSFTGSTEVGRLIQAAAAN
SNLKRVTLELGGKSPNIVFADTENIDVAVEQAHSALFFNQGQCCSAGSRTFVQDTIYDEF
VKKSVERAQNRTVGDPFDDEIQQGPQIDKEQFDKILDLIASGKKEGAKLECGGARHGDKG
YFIQPTVFSDVKDHMRIAKEEIFGPVQQIIKFSDVNEVIERANNTTYGLAAAVFTKDIDK
ATTLSHSLQAGTVWVNCYDCGGPQAPFGGFKMSGFGREWGEYGLLPFLEVKTVTMKVPSK
NS
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggatgcttccaagagaggccaactcttatacaaaatggcagacctcattgagagagac
ttggactatcttgcttccctggagacaattgacagtggaaaattatttgccgattcagta
gatgacatggaatttactgtaaaatgcttcagatactatgctggatgggctgataagata
acaggaaagactatatcttctgatggtccttactttgtgtacaccagacatgaacctgtg
ggtgtggttggagctattgtaccatggaatttccctcttaatatagcatgtttaaagctt
tctgcagctctggcttgtggcaatgttgtaatagttaaaccagctgaacagactccctta
acagcactgtatgtgggttccttgtttaaagaggcaggatttcctcctggtgtggtgaat
atcatctctggttatggtccaacagcaggagcagcaatttctgaacacatggacatcaac
aaagtttcattcacaggatcaacagaggttggaaggttaatacaagcagctgctgcaaac
tccaatttaaagcgtgtaacactggaactcgggggaaagagcccaaatatagtttttgct
gatactgaaaatattgatgttgcagtggaacaggcacactctgcactgttctttaaccaa
ggacagtgctgcagtgctggcagtcgcacttttgtgcaagacaccatttatgatgagttt
gtaaaaaagagtgtggaaagagctcaaaaccgcacagttggtgatccttttgatgatgaa
atccaacaaggaccacagattgataaagaacagtttgataaaatccttgatctgattgca
agtggaaaaaaggaaggagcaaagcttgagtgtggtggtgctagacatggagacaaagga
tatttcatacaacctacagtcttctcagatgtcaaagaccacatgaggattgccaaagaa
gagatatttggtccagtgcagcagatcatcaaattcagtgatgtaaatgaggttattgaa
agggcaaataacacaacatatggcctggctgctgctgtatttaccaaagatatagacaaa
gcaacaacactttctcacagcttacaagctggaacagtttgggtcaactgttatgattgt
ggggggcctcaagccccctttggaggattcaagatgtctggctttggccgagaatggggt
gaatatggtctcttacccttcttggaagtgaaaacagttaccatgaaggtcccttcaaag
aactcgtaa

KEGG   Pocillopora damicornis (lace coral): 113684511
Entry
113684511         CDS       T05773                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113684511
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     113684511
SSDB
Motif
Pfam: Aldedh DUF1350 LuxC
Other DBs
NCBI-GeneID: 113684511
NCBI-ProteinID: XP_027057696
Position
Unknown
AA seq 527 aa
MAFRLPLRSLSRVVPRRLFAPPASISRSSFATLAERKIDDSPEVKYNQVFINNRFVDSVS
GKTFPTINPATGEKICDVAEGDKADVDIAVKAAKEAFKLGSPWRTMDASERGKLLNRLAD
LLERDQAYLASLETLDNGKPFNDSFNIDLSMTIKCYRYYAGWADKIHGKTIPIDGSFLTY
TRHEPVGIVGQIIPWNFPLLMQAWKLGPALAAGNAIVMKPAEQTPLTALYVASLIAEAGF
PPGVVNMVPGYGPTAGMSIAEHMEIDKVAFTGSTEIGHVIMQAAGRSNLKNVTLELGGKS
PNVVFADSDIDSAVEMSHFALFFNQGQCCCAGSRCFVEEPIYDEFVQRSVERAKSRVVGN
PFDLNTEQGPQVDQEQFSKVMSLIESGNKEGANMVFGGGRHGDKGYFVQPTVFTDVQDHM
RIAKEEIFGPVMQIMKFKDMNELIERANNTIYGLAASVFTKDIDKMNTIAHSIRAGTVWV
NCYDVLDVQAPFGGFKMSGSGRELGEYGLEQYSEVKTITIKLPQKNS
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcatttcgtcttcccttgaggtcactttcacgagtcgttccaagaaggctttttgct
cctcctgcttccatcagtcggtcttctttcgcaacgctcgctgagcgtaagattgatgac
agtcctgaagtgaagtacaatcaggttttcatcaacaacaggtttgtggactctgtcagt
ggcaagacattccccacaatcaaccctgcaactggggaaaaaatatgtgatgtggctgag
ggtgacaaggcagatgttgatattgctgttaaggcagccaaagaggcctttaagctaggc
agtccttggagaacaatggatgcatcagaacgtggaaagcttttgaacagactggctgat
ttgcttgaacgagatcaagcttatcttgcaagtttagagactttggacaatggcaagcca
ttcaatgattctttcaatattgatttatccatgacaattaagtgctatcgatactatgct
gggtgggcagacaaaattcatggcaagacaattccaattgatggcagtttcttaacctat
acccgccatgaacctgttggcattgtcggtcaaataatcccatggaacttcccactgctg
atgcaagcctggaaacttggtccagccctggcggctggaaatgcaattgtaatgaaacca
gcagaacagacaccactgactgccttatatgtggcgtctctaattgctgaggctggtttc
ccgccaggtgttgtaaatatggttccaggctacggacctacagcaggaatgtcaatcgct
gaacacatggagattgataaagttgccttcactggctccactgagattgggcatgtaatt
atgcaagcagctggcagaagcaacttgaagaacgtcaccctggaacttggtggcaagagt
cctaacgtggtgtttgctgattccgatatcgacagcgcagtggaaatgagtcactttgct
ctgttcttcaaccagggtcagtgttgctgcgctggcagccgctgtttcgtagaggagccg
atttacgacgagtttgtgcaaagaagtgtggagagggccaaaagccgtgtcgttggaaac
ccttttgatttgaatacagaacaaggaccacaggttgatcaggagcagtttagcaaggtt
atgtccctgatagaaagtggaaacaaggaaggtgccaatatggtctttggaggagggagg
catggtgacaaaggctactttgtgcagcccaccgtctttactgatgtccaagatcacatg
agaattgcaaaggaagagatttttggacccgtgatgcagatcatgaaattcaaggacatg
aacgaattgattgaacgagctaacaataccatttatggtttggctgcctctgtgtttacc
aaggacattgacaagatgaatactattgcccacagcatccgtgctggcactgtttgggtc
aactgttacgatgttctggatgtccaagcgccatttggtggctttaaaatgtctggatca
gggagggaattgggagagtatggtcttgagcaatattcggaggtgaaaacgataacgatc
aagctcccgcagaagaattcttaa

DBGET integrated database retrieval system