KEGG   Pocillopora damicornis (lace coral): 113683131Help
Entry
113683131         CDS       T05773                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00010  Glycolysis / Gluconeogenesis
pdam00562  Inositol phosphate metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113683131
   00562 Inositol phosphate metabolism
    113683131
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113683131
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113683131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 113683131
NCBI-ProteinID: XP_027056145
Position
Unknown
AA seq 472 aa AA seqDB search
MMVTVSKVITSVIFFAILGCAVNERENKSSKKTWLKFGSKTRYQRKEIPFEAPIGCDPLH
ISMVIRHGTRYPSKKDVKKIEKMLDVINEEIDSNWSVGDLHLPWKNPFSLDHDKLLASAG
EEELYSLAKEFLKRFPSLLSHPYHPHNFDFISTGTSRTVQSAMAFAFGLFEGRGRLGASG
FQPVAVESKETNNDHLLRFFDVCPMYNVKVADNDTALHEHKKFKRGIKMERIGHKIQRLM
TKRPDNPQTTFTAETIIGMYTACIFEVAIFNRENTWCLLFDKEDFLTLEYLSDLKHYWKR
GYGYPITYQIGCPLLGNIVSSLKNATDPSSSEKKYGNFMFAHSETLQPLYALLGLFKDQE
KLRAGNMNVHSGRKYRTSEIVPFGANIAFVVYSCNADDNSCGKESDSYKMGPFKIQVFVN
EELVALPCCGEQRECPLETFLQCFDTKQNGSCNLSSLCSLESNSAENYHGEL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgactgtctcgaaagtgatcacatctgtcattttctttgcaatactaggatgt
gctgtcaatgaaagagagaacaaatcttcaaagaagacatggcttaagtttggatcaaaa
acccggtatcaacggaaagagatcccatttgaagcgcccataggttgcgatcctcttcac
atcagcatggtcataagacatgggacgcgctatcctagcaaaaaggacgtgaaaaaaatt
gaaaaaatgcttgatgtgatcaacgaggagatcgattcaaactggtctgttggagaccta
catcttccttggaaaaatcccttttctcttgatcatgacaaacttttggcatccgctgga
gaagaagaattgtattctctcgccaaagaatttctgaaacgttttccaagcttgctatcg
cacccgtatcatccgcataacttcgatttcatcagtacgggaacttccagaacagtacag
agtgctatggcttttgcgtttggtttgttcgaggggcgaggtaggctgggtgcgagtggt
tttcaacctgtggcagtcgagtcgaaagaaactaacaacgatcatttacttcgctttttt
gatgtatgcccaatgtacaatgtgaaagttgcagataacgacactgcacttcatgagcac
aaaaagtttaaacgtggtataaaaatggaacgtattggtcataaaatacaacggctcatg
acaaagcgtcctgataatccccagacaactttcacagcagaaactattattggaatgtac
actgcttgcatttttgaggttgcaatctttaacagagaaaatacttggtgcctccttttt
gacaaggaagatttcttgactctagagtacttatcagacttgaaacattattggaagaga
ggctatggatacccaataacctatcaaattggatgccctttattaggaaacattgtaagc
agccttaaaaatgcaacagatccatcttcaagtgagaaaaagtatggcaattttatgttt
gcccatagtgagactctacaacctctttatgccttgcttggattattcaaagatcaggag
aaactgagagctggcaacatgaatgtgcactctgggcgcaaatacagaaccagtgaaatt
gtgccatttggagcaaacattgcatttgttgtatacagttgcaatgcagatgataactct
tgtggtaaggaatcagatagttacaaaatggggcctttcaaaatccaagtatttgttaat
gaagagttggtagctttgccttgttgtggtgaacagagagagtgccccctagagacattt
ttgcagtgttttgacactaaacaaaacgggtcatgtaacctgtcatcattatgcagcttg
gaaagcaacagtgctgaaaactatcatggggaattgtga

DBGET integrated database retrieval system