KEGG   Pocillopora damicornis (lace coral): 113684107Help
Entry
113684107         CDS       T05773                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00564  Glycerophospholipid metabolism
pdam00565  Ether lipid metabolism
pdam00590  Arachidonic acid metabolism
pdam00591  Linoleic acid metabolism
pdam00592  alpha-Linolenic acid metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113684107
   00565 Ether lipid metabolism
    113684107
   00590 Arachidonic acid metabolism
    113684107
   00591 Linoleic acid metabolism
    113684107
   00592 alpha-Linolenic acid metabolism
    113684107
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     113684107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 113684107
NCBI-ProteinID: XP_027057234
Position
Unknown
AA seq 754 aa AA seqDB search
METTPFQCSYRQCYELIVNVVCGRNITLGAWNDTFDTPDPYVKLFIPTAPNGRKKTQTVS
NSKNPVWNKEFKFLIDKELENVLCEYNFLQMELILNFKNGRFLFSFTVFLIINLVLVFSS
SDITLMEDDTFSDDLVGETETFPLSGLEIDRILRKTFVFRQTSEVDITLELKNRAEPRDM
RYSLKLCKDEIDFRENRKPFLFQAMRKLLGPRGPKSMDEIPTVGIVGSGGGFRAMVGLSG
VFCALEDMGVLDCAMYAAGLSGSTWYLSTLYSHPEFPNIHPKKVMEQLRQNVQHNWIWML
TPSWLYKHIQIIHQKKIQGQPISFTDFFGYLVGETILRDRKNIPKLSDQRGAVKHGNVPL
PLYTCVHVKNDVSAKAYNEWMEFSPYEIGMAKYGTFMKTEDFGSKFFCGHLHTKYPEPPL
EYLQGIWGSAFTILLQRMLGEGQAPSAIRKFRRSSSSMREDLHKILYPDNGHDDEESDSE
DEEHGVEGLKEVPVFDEEDMEEPKEDHNDPGLLGRIAQRFMNKFPVLQTRSGRAGRVHNY
LRGLGLAFAPVPFESEDVTDTADHPTLKAKRIYLADSGLVFNSPYPLVIRPQRGCDVLLS
FDFSARDKEIEMPFEELLLAEEWARKNKLKFPPINAEEQYQKHGLKEFYVFSDPEDPECP
VVIHFVLMNGSFKDHSRPGVPRKTSSEKEFGAFAIFEDPDNHYSTFNFHYPHKAFDRLTQ
LMEFNTLLAKETIKDVIADGVRRKRQLKAMRSSR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaactccgttccagtgctcctaccgccaatgttatgaactcatcgtcaacgtc
gtgtgtggaagaaacatcacacttggcgcctggaatgacaccttcgacacaccagatcca
tatgtaaagttatttatccctactgctccgaatggacggaagaaaacacagacggtatcc
aactctaaaaaccctgtttggaacaaggaattcaagtttctcattgacaaagagttggaa
aacgttttatgtgagtacaacttcctgcagatggaactgattttaaactttaagaacgga
agatttctcttttctttcactgtcttcttaatcatcaacttggttttggttttctcttcc
tcagatattacactgatggaagatgatacatttagtgatgatttggtcggggaaacagag
acatttcccttgagtggtctggaaatcgataggattttgcgcaaaactttcgtatttcga
cagacttcagaagtggacattacgctcgagcttaaaaaccgtgcagaaccccgtgacatg
cgatacagcttgaaactatgtaaggatgaaatcgattttcgagagaacaggaaacctttc
ttgtttcaagcgatgaggaagcttctcggaccaagaggaccaaagagtatggatgagata
ccaactgtgggtattgttgggtccggaggtggttttcgagccatggttggccttagtggt
gtgttttgtgcgctagaagatatgggtgtgttggactgtgccatgtatgccgcgggattg
tcaggatcaacttggtacctctccacgttgtattctcatcctgaatttccaaatatccat
ccaaagaaagtgatggaacagctgaggcaaaacgtgcaacacaactggatctggatgttg
acaccttcgtggttgtacaagcacatccaaatcatccatcagaaaaaaatacaaggccag
ccaatcagttttaccgatttctttggctacctcgtgggtgaaaccatcttgagagaccgc
aaaaatattccaaaactgagcgatcaacgtggcgcagtcaaacacgggaacgttcccctt
ccgctttacacatgtgtgcacgtgaagaatgatgtttcggcaaaggcatacaatgaatgg
atggagttcagcccttatgaaataggaatggctaaatatggcacttttatgaaaacggag
gattttggaagcaagtttttctgtgggcaccttcacacaaagtatcctgagcctccactt
gaatatctgcaaggcatctggggcagtgccttcaccattttactgcaacgcatgctcggt
gagggtcaagcaccgagcgcaattagaaaatttcgccgcagctcctccagtatgagagag
gacttacataagattctgtatccagacaacggacacgatgacgaggaaagcgacagtgaa
gatgaggaacatggcgttgagggtctaaaagaagtaccagtctttgatgaagaagacatg
gaagaaccaaaggaagatcataacgatcctggattgttgggcagaatagcgcagagattt
atgaacaagttccctgtgctacaaactcgctccggtcgcgcgggaagggtgcataattac
ttgcgtggtctagggcttgcgttcgctccagtccccttcgaatctgaagacgtcactgat
accgctgaccatcctaccctgaaggctaagcgcatatacctggctgacagtgggctcgtg
ttcaattctccgtatccattggttataagaccccagcggggatgcgacgtactcctgtca
tttgacttcagtgcaagggacaaagagatagagatgccctttgaggaacttttgctggca
gaagaatgggcacgaaagaacaaattgaaattccctcccattaatgccgaggaacaatac
cagaaacatggtctgaaggagttctatgtgttctcagatcctgaagacccagaatgcccc
gtagtcatacactttgtgttgatgaacggctctttcaaagaccatagccgtccaggtgta
cctcgcaaaacctcttcagaaaaggaattcggagcattcgcaatttttgaagaccctgat
aatcattacagcacattcaacttccattaccctcacaaagcatttgatcgcttgactcag
ctgatggaattcaacacactattggcgaaagaaaccatcaaagatgttatagctgatggc
gtcagaagaaaacgtcagctgaaagcgatgaggagttcgagataa

DBGET integrated database retrieval system