KEGG   Pocillopora damicornis (lace coral): 113684416Help
Entry
113684416         CDS       T05773                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00071  Fatty acid degradation
pdam00410  beta-Alanine metabolism
pdam00592  alpha-Linolenic acid metabolism
pdam00640  Propanoate metabolism
pdam01040  Biosynthesis of unsaturated fatty acids
pdam01100  Metabolic pathways
pdam01200  Carbon metabolism
pdam01212  Fatty acid metabolism
pdam04146  Peroxisome
Module
pdam_M00087  beta-Oxidation
pdam_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    113684416
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113684416
   00592 alpha-Linolenic acid metabolism
    113684416
   01040 Biosynthesis of unsaturated fatty acids
    113684416
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113684416
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113684416
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     113684416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N DUF3675
Motif
Other DBs
NCBI-GeneID: 113684416
NCBI-ProteinID: XP_027057590
Position
Unknown
AA seq 706 aa AA seqDB search
MSEFSMKPVSHSENKDEVVGHFPPGPLDSYREHASFDWFQMKVFLDGGEDVVRFQHNMWK
TMEKDSLFDRVNDWKLSMDERRRVTMKRCKRIAEYNFLTEDDIMAAPLLVQAFGDALGIY
DWSLSTKFTLNTTMFARQVRTSSTHEHIQELADKAMRFEVFGCFALTELTHGSNTKGVQT
TATYDPSSQEFVVHTPNYEATKCWVGNLGRTATHAIVYAQLYTPDGVCHGLHSFVIQVRN
TTDLLPMPGVTVGDLGEKLGQNGLDNGFVSFNHVRIPREHLLNRTADVTPAGKYVTPFKD
PNKRFGAALGALSGGRVGITSMAVINLRLCMSIAIRYSAVRKQFGPPGKDEIPVLEYQMQ
QWRLIPKLAATYALAYFARTFFMNFVELQVGMMMGESGEIQAALGREIHALSSASKPLAS
WIAQSTIQECREACGGHGYLAINRLGELRNDNDPNCTYEGDNNMLLWQTSSYLLSQLDAK
QKGSHISSPLHTADFINDIEQIMTHQFHASTEQECRNPDFLVGAYQWLVCYLLKESAQKF
KQELTSGKDSFAAKNDSQVFYCRSLALAFIECTILKRFKEAIFNEDEIPQALKPVLLRLC
SLYGLSSLETHLTTLYQGGFCCSVNDARIVRAAILTLCCELKNEAVALVDALAPPDFILN
SPIGHSNGKAHENLHAAIMQKPENKERITWWKECRQLPIIRDRSKL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagttctcgatgaaacctgtttcgcacagcgaaaacaaagatgaggtcgtagga
cactttcctccaggaccattggatagttatcgagagcacgcttccttcgactggtttcag
atgaaagtgtttttagatgggggagaagatgtagtcagattccagcacaatatgtggaaa
actatggagaaagactcgttatttgaccgtgtcaacgattggaaattgagtatggacgaa
cgcaggcgtgtaacaatgaaacgatgtaagagaattgcggagtacaattttttgacagaa
gatgatattatggcagcaccactcttggttcaggcatttggtgacgccttaggaatatac
gactggagtttatcaacaaaattcactttaaacactacgatgtttgctcgtcaagttaga
acatcaagcacacacgaacacatccaagagcttgcagataaagctatgaggtttgaagtc
ttcggttgttttgctctgactgagttaacacatggaagcaatactaagggtgttcaaacc
acagctacttacgatccatcatcacaggagtttgtggtccatacacccaactatgaagct
acaaagtgttgggtgggcaacctgggtagaactgcaacccatgccatagtctatgcacag
ctttacacccctgatggagtctgccacggactccactcctttgtcattcaagtacgaaac
accacagatctcttacccatgcctggggtgactgtaggagatcttggagagaaactgggt
caaaatggactagataatgggtttgtgtcttttaaccatgttcgtattccacgggaacac
ttgctgaacagaacagctgatgtgacacctgcagggaagtatgttacaccatttaaagac
ccaaacaaaagatttggtgctgcactgggtgctttgtctggtgggcgagttgggataaca
agtatggcagtgatcaacttgcggctgtgtatgtctattgctattaggtactctgctgtt
agaaaacagtttggtccacctggaaaggatgaaattcctgtgttagaatatcaaatgcag
caatggagactgattcccaagttagcagcaacatatgctttagcttattttgcaaggacc
ttctttatgaattttgttgagctacaagttggtatgatgatgggagaatcaggtgaaata
caagctgctttaggacgtgagatccatgccttgtcatctgctagcaaacctctggccagt
tggattgcacaaagtactattcaggaatgtcgtgaggcctgtggtggccatggttacctt
gcaatcaacaggttaggtgaattaagaaatgataatgaccccaactgcacttatgaagga
gataataacatgcttctgtggcagacaagtagttatctcttatctcagctggatgctaaa
cagaaaggttcccatatttccagtccccttcacacagctgacttcataaatgacattgaa
caaatcatgacacatcaattccatgcaagcacagagcaagaatgtagaaaccctgatttt
cttgttggagcataccaatggcttgtttgttacctactaaaagagagtgcccagaagttt
aagcaagagcttacaagtggaaaggactcctttgcagctaagaatgacagccaagtattt
tactgtaggtcattggcacttgctttcattgagtgtacaattttgaagagattcaaggaa
gcaattttcaatgaggatgaaattccacaagctcttaaaccagttcttctcagactttgt
tcactatatggcttgtcctctctagagacacatctcactactctataccaaggtggcttt
tgttgctcagtgaatgatgccagaattgtgagagcagccatacttactctttgttgtgag
ttgaagaacgaagctgtagccctggtggatgccttagccccaccggattttattcttaac
tcacccattggtcacagtaatggaaaggctcatgaaaacttgcatgctgcgattatgcaa
aaaccagagaacaaggaacgaattacatggtggaaggagtgtcgtcaacttcccattatc
agagatcgtagcaagttatga

DBGET integrated database retrieval system