KEGG   Pocillopora damicornis (lace coral): 113684761
Entry
113684761         CDS       T05773                                 

Definition
(RefSeq) retinol dehydrogenase 7-like isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113684761
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     113684761
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 113684761
NCBI-ProteinID: XP_027057959
Position
Unknown
AA seq 382 aa
MGSAGGESVCFGALEREQEIELQGAMERADSFYAVALLVAAMCALWIIKRLYKDTFLTDF
REKYVLVTGCDSGFGRETALRLDSLGFNVFATCLTSEGKENLTAACSKRLSALHLDVTDS
EEIKKTYKFVAQYLPENRGLWGLINNAGIAKVGPIEWQTIEEFKQIADVNLWGLIDVTKV
FLPLVKKERGRIINLASIGGRTCLPHASAYSISKFGVEAFSDALRRELGPTGVKVSIVEP
GFFQTKITNPDNLKGQWQDLWTNLSHSLKEEYGEKFYETSVKNMLTGMVDTCASPHLYKV
VDAIVHSLTSRYPKTRYMVGWDAKLLWIWVSRLPAGVGDAILNFLGDKAEPIVCTGAVTR
PCKSLGKLNGNNNSEKAFALRK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggcagcgctggtggtgaatcggtatgcttcggggctttagaaagagaacaagagatt
gaattgcaaggtgctatggagagagcagacagcttctacgcggtagcgttgctcgttgcg
gcaatgtgtgctttgtggatcatcaaaaggctctacaaagatacatttttgactgatttt
cgtgagaagtatgttttggtcactggttgcgattcaggattcggaagggaaactgcatta
cgactcgacagcctgggattcaatgtatttgcgacgtgtctaacgagcgaggggaaagaa
aacctaaccgcggcgtgcagcaaaaggctatccgctttgcacttggatgttacagactcg
gaagaaatcaagaagacatacaagtttgtggcgcagtatttacctgaaaatagaggtttg
tggggtctgataaataacgctggcatcgctaaagttggaccgatcgagtggcagactatt
gaagagtttaaacaaatcgcagatgtgaacctttggggactgattgatgtcaccaaggtg
ttcttaccgctggtcaaaaaggagcgaggacgcatcataaacctcgctagtatcggaggt
agaacgtgcttacctcacgcatcagcatattccatttccaagtttggtgtagaggcattt
tcggatgctctccgtcgtgaactgggtccgactggtgtcaaggtcagcattgtggaacca
ggcttttttcagacaaaaatcaccaatcccgacaacctcaagggtcaatggcaggatctc
tggaccaacctgagccacagtttaaaagaggagtacggggagaagttctacgaaactagc
gttaagaacatgctaacaggaatggtagacacatgtgcctcaccccacctgtacaaagta
gtcgacgccattgttcactcactgacgtcaagatatcccaagaccaggtacatggttggc
tgggatgctaagctcctctggatttgggtctctaggcttccagcaggtgttggagacgcc
atattgaattttttgggtgacaaagctgaacctatcgtttgcacaggagcagtaacgcgg
ccgtgcaaaagtttagggaaactaaacgggaacaataattcagaaaaagcttttgctctc
aggaagtga

DBGET integrated database retrieval system