KEGG   Pocillopora damicornis (lace coral): 113685326Help
Entry
113685326         CDS       T05773                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113685326
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pdam04812]
    113685326
   04147 Exosome [BR:pdam04147]
    113685326
Membrane trafficking [BR:pdam04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    113685326
Cytoskeleton proteins [BR:pdam04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     113685326
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113685326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase Ras GTP_EFTU ABC_tran AIG1 AAA_16 AAA_22 DUF3584 Roc AAA_29 NACHT Exonuc_VII_L FtsK_SpoIIIE Dynamin_N
Motif
Other DBs
NCBI-GeneID: 113685326
NCBI-ProteinID: XP_027058621
Position
Unknown
AA seq 450 aa AA seqDB search
MMASIKKYSFTTKASAKGMEGYVGFANLPNQVFRKSVKKGFEFTVMVVGESGLGKSTLLN
SLFLTDIYTPAAYPSVEERLNKTVSIKPSTIEMKEGGVRLRLTVVDTPGFGDAVDNTDCW
KPIIEYIDNKFEEYLNAESRVVRSPFPDDRVHCCLYFIAPTGHCLKPLDIEFMKRLHNKV
NIVPVIAKADTLTHDECTKFKKQILKEIEENDIGIYRFPDLGGDDDDDVAAVSMKDRIPF
AVVGSNTVLEVNGKRVRARVYPWGVAEVENVDHCDFVALRNMLIRTHMQDLKDVTNDTHY
ENYRCEKLAAMTVGSPTNQPSSNVSLSRSPLEQLEAEKEEREMKLKKMEQEMEQVFEMKV
KEKKKKLKDSEAELGKKNEQMWKQLDQQNKELEEKRKQFEREKGHYEEELKSNGLKGLER
SDSSSKSLKSVDGLVKEKDGKKKEKRKGFF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcgatcaaaaaatattcattcacgacgaaagcgagcgctaaaggtatggag
ggctacgttggttttgctaatcttccaaaccaagtttttcgcaagagtgtcaagaaagga
ttcgaattcaccgtcatggtggtcggtgaaagtggactgggcaaatcaacacttctgaac
tcactgtttttaactgatatctacacacctgctgcatatccaagtgtagaggaacgactc
aacaaaactgtttcaataaaaccttcaacaattgagatgaaagagggaggtgtgcgactg
agactaacagttgttgatactccaggattcggagatgctgttgacaacactgactgctgg
aagcccattattgaatacatagacaacaaatttgaagaatatttaaatgcagaatcaaga
gtggtcagatcacctttcccggatgacagagttcattgttgcttgtactttattgcacct
acagggcactgtctaaaacctttggatatagaatttatgaaaagacttcataacaaggtt
aatattgtaccggtgattgcaaaagctgacactttgacccatgatgagtgcaccaagttc
aaaaaacagatacttaaggaaatagaggaaaatgacattgggatttacagatttccagac
cttggaggagatgatgatgatgatgtagcagctgttagtatgaaggacagaatacctttt
gcagtggttggtagcaacacagtcttagaagttaatggcaagagagtaagagcccgagtg
tacccttggggtgtggccgaagttgaaaatgtagaccactgcgattttgttgctttaaga
aacatgctgatcagaacgcatatgcaggatctcaaggatgtgacgaacgacactcactac
gaaaattatcgctgcgaaaagctggcggccatgaccgttggctcacctactaatcagcca
agttctaacgtgtctctcagtagaagtcctctggagcaactggaagctgagaaagaggaa
cgagaaatgaaactgaagaaaatggaacaggaaatggagcaagtgttcgaaatgaaagtc
aaggaaaagaaaaagaagctcaaagattctgaggcggagcttggcaagaaaaacgaacag
atgtggaaacagctcgaccagcagaacaaggagctagaggaaaaacgaaaacagttcgag
agagagaagggacactacgaggaagaactgaaaagtaatggcctgaagggtctggaacgg
tctgactcctccagcaaatcactcaagtcagtagatggtctagtgaaagaaaaagatggc
aagaaaaaagagaagagaaagggtttcttttaa

DBGET integrated database retrieval system