KEGG   Pocillopora damicornis (lace coral): 113685342Help
Entry
113685342         CDS       T05773                                 

Definition
(RefSeq) glutathione synthetase-like
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00270  Cysteine and methionine metabolism
pdam00480  Glutathione metabolism
pdam01100  Metabolic pathways
Module
pdam_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    113685342
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113685342
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113685342
Enzymes [BR:pdam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     113685342
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113685342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 113685342
NCBI-ProteinID: XP_027058641
Position
Unknown
AA seq 476 aa AA seqDB search
MFSSFLRGDLSDNEVDFLASEGRDYFLTRGMIYKNKSGNLEHRPFTVLPTPFPRRLFAAA
REVQKDFNLLVHKASQDFQFTKDALLSTITADVFTAKIFAIYEKTQEQGIDQPISLGIFR
SDYMLEQTSGSHNQEDENLNLCIKQVELNTISISAISSSCRASSLHRHLLNLIGKEEKSP
PPNFALDEVAEGLIKAWELYESPSAVIMFVVRPDEVNVYVQRILEYSIRDKNRAVKVIRR
TLTEICTRSEIQGDKSLFVDGLEVAVAYFRAGYTPVDYPSEDEWSARLTIELSRCIKCPT
VAHQLMGTKKMQQVFAEPGVLERFLPNREAVDRVRATFTGLYTLDPGPSGDRNVECCLQA
VERFVMKPQREGGGNLIYGEDIRHTLQSNPEKRSQYILMDRIRPACINRNFIVRQESIKP
AEIISELGIFGIFLSQGDEILINKDGGYLVRSRPWDKLEVISLHGEGAYCSPYLVD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgtcctttctaagaggtgacctttcggataacgaagttgattttctcgcctca
gaaggccgagactattttctcacccgcggaatgatttacaaaaacaagagtggaaattta
gagcacagaccctttactgtccttcccactccatttccaagaagacttttcgcagctgcc
agagaggttcaaaaggattttaatttgctggtgcacaaggcaagccaggatttccagttc
acgaaagacgcacttctgagtaccataactgcggatgtattcacagcaaaaatatttgcc
atttacgagaaaactcaagagcaaggcatagatcagcccatttcgttgggaatcttccga
tcggactacatgcttgaacaaacaagcgggtcgcacaaccaagaagacgaaaacttaaac
ctttgtatcaaacaagttgaactaaacactatttccataagtgccatatcttcatcatgt
cgtgcttccagccttcacagacatctgttgaatcttattggaaaagaggagaagtcaccg
cctccaaactttgcactcgatgaagtagctgagggactcattaaggcctgggaactatac
gagtcaccgagtgcagttatcatgtttgtcgttcgtcccgacgaagtaaatgtgtatgtc
caaaggattctggaatacagcatcagagacaaaaaccgcgctgtaaaagtgatcagacga
accttgaccgaaatttgtactcgaagcgaaatacagggcgacaaatccctctttgtggat
ggacttgaggtcgctgtagcttactttagagcaggttacacacccgttgactaccctagt
gaagacgaatggtcagctcgtctgacaatcgagctgtctcgttgtattaaatgcccgaca
gtggctcatcagttgatgggaaccaaaaagatgcaacaagtatttgctgaacctggagtt
ttagaaaggtttttaccgaatagagaggcagtggacagagtaagagcaacctttactgga
ttatacactctcgatccgggaccatcaggagatcgcaatgtcgagtgttgtctccaagcc
gtggaaaggtttgtcatgaaacctcagagggaaggaggaggtaatctcatctatggggaa
gatatccggcacacactccaaagcaatcctgaaaagcgttctcagtatattttgatggac
cgaattcgacctgcttgcatcaacaggaactttatcgttcgtcaggagtccataaaacct
gcagaaattatctctgaactggggatttttggcatttttctcagtcagggagatgagata
ctgatcaacaaagatggaggctaccttgtccgcagtaggccatgggataagttagaagtg
ataagtcttcatggagaaggcgcctactgcagtccatatttggtagactag

DBGET integrated database retrieval system