KEGG   Pocillopora damicornis (lace coral): 113686401Help
Entry
113686401         CDS       T05773                                 

Definition
(RefSeq) polyamine oxidase 7-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00330  Arginine and proline metabolism
pdam00410  beta-Alanine metabolism
pdam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    113686401
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113686401
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     113686401
    1.5.3.16  spermine oxidase
     113686401
    1.5.3.-  
     113686401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 FAD_binding_2 DUF2633 Shikimate_DH Pyr_redox_3 AlaDh_PNT_C FAD_binding_3 Thi4
Motif
Other DBs
NCBI-GeneID: 113686401
NCBI-ProteinID: XP_027059818
Position
Unknown
AA seq 494 aa AA seqDB search
MYIMIKIILLVSFLFLVDRSLSSPIKQSKTKVLILGAGLAGIKAAKTLLDRNITDILILE
GMNYTGGRIHAVKFANYTIETGANWIHFMNEDDTKPLVERKEARGVRVHKYNYSNIIVRD
EDGRDVTDFAVLHEFDDKVTNKIEDFQDERRTKNFPDMPARVGLQLMGWEGKRPIERAIE
YFELDYEFAKPPEEVSFYNLFVPGEEFLVTDERGVWSMFEDLYKPLEKKTLLGKTVTKIK
LNPDSVEAQTSDGWSYQADYALCTFSSGVLASDLVTFEPALPDWKKEAIYKNPLSIYTKI
YLKFPKKFWDDREYILYASKERGRFPVWQDLSRPGVYSVDSGMLEIMVTGTEGRRIEGQS
FNETKAEIMKILRQVYGEGVPEATDIYYHRWSKEPLTQGAFSEPVVGMTSEDWKNIGKNL
GRLYFAGEATHDEWFGYMQGAYLSGDEKGKRIAEQISPSEPTSKPRKPKSEATSVKMSSL
GILLLSYFCSCLCI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcatgattaagatcatcctgcttgtgagttttctgtttctggtggacagatct
ttgtcttcaccaataaaacaaagcaaaactaaagtccttattcttggcgctggactcgct
ggaattaaagcagcgaaaacgctactggacagaaacatcaccgacattctgattctggaa
gggatgaattacactgggggtagaatacatgctgtgaaatttgcaaactacacgattgaa
acgggagcaaactggattcactttatgaatgaagatgacaccaaaccattggtggaacga
aaggaagcgagaggtgttcgtgttcacaaatataattattcaaacattattgtgagggac
gaagatggcagagatgtcaccgattttgctgttttacatgagtttgatgacaaagtgaca
aacaaaattgaagacttccaagatgaaagaagaacaaagaactttcccgacatgcctgcc
cgcgttggtcttcaactgatgggatgggaaggaaaacggcccatagaaagagccattgaa
tattttgaattagactatgagttcgcaaaacctccagaagaagtttctttctacaatttg
tttgttcctggagaagagttcttggtgactgatgagcgaggagtgtggtctatgtttgaa
gatctgtataagccactggaaaagaagactttattgggcaaaactgtcacaaaaatcaag
ctaaacccggattcggttgaagctcagacctccgatggttggagttaccaggcagattac
gctctttgtacattcagctccggagttctggccagcgacttggttactttcgagccagcc
cttccagattggaaaaaagaggccatttataaaaacccattatcgatatacacaaaaatt
tacctgaaatttccaaaaaagttctgggatgatcgcgaatatattttgtacgcttccaaa
gagcgcgggcgtttccctgtgtggcaggacctgtcaagacccggggtatattctgttgac
agcggaatgttagaaattatggtaactggaaccgaaggacgaaggattgaggggcaatca
tttaatgaaacaaaggcagagatcatgaaaatactgcggcaggtttatggagagggcgtc
cctgaagctacggatatatactatcaccgctggtcaaaggaaccgctgacacaaggcgca
ttttcagagccagtggtgggtatgacttctgaagactggaagaacattggaaaaaacctg
ggacgactgtactttgctggcgaagcgacacacgatgagtggttcggctacatgcaagga
gcttatctaagtggagacgagaaagggaaaagaatcgctgaacagatctccccgtctgag
cctaccagtaagccacgaaaaccgaagagtgaggcaacttcggtgaagatgtcttcatta
ggaatcttgttgctttcctatttttgctcatgtctctgtatttaa

DBGET integrated database retrieval system