KEGG   Pocillopora damicornis (lace coral): 113687155Help
Entry
113687155         CDS       T05773                                 

Definition
(RefSeq) probable NADH dehydrogenase
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113687155
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     113687155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 113687155
NCBI-ProteinID: XP_027060663
Position
Unknown
AA seq 486 aa AA seqDB search
MLCITANVPVKGSETRWTTYMLIKVKKKLKFAAMISTLNLKTLSRLTLSQCFVTRSLRTS
AIAVQNTQKKELGDRQRLVILGTGWGSYSVLKQIDKKLFDVIVVSPRNHFLFTPLLCSTT
VGTLEFRSIIEPVRNTGFRDEHHFQQAEAVELLPDEHTVVCKSTLNGDRYDLKYDKLVIG
VGAVSNTFGVPGVYDHAFFLKEISDARMIRNQILKNFELAMQPGVSEEEKKRLLHFVIVG
GGPTGVEFGAELYDFVKQDVTRLYVHERSNVRVTLIEARQILPSFDEKLRTFAESKMRQR
DQFELLQSSVTQVCADHIQLKDGEKLPCGLVVWSTGLAPRPFTASVKLPKNNNSQLVVDK
FLRVQGIDDGSIFAIGDCSFIEANPYPCTAQVAEREGSYVAKSLGLSAQGRGSEVEPFSW
RNIGMLAYLGDYQGLADFPTSKLQGFKSWILWRSVYFTKLGSWRLRFQVPFDWMRTFIWG
RDVSQF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcataacagcaaacgtcccagtcaagggttcagaaacaagatggacgacatat
atgctgattaaagttaaaaaaaaacttaaatttgcagctatgatttcaacattaaactta
aaaacactttctagactgactctttctcaatgctttgtgacaagaagccttcgaaccagc
gcgatcgctgttcaaaacacgcagaagaaagaacttggcgatcgacaaaggctggtcatc
ttgggaactggttggggaagctacagcgtgttgaaacaaatcgacaagaaactatttgat
gttattgtggtcagtcctcgtaaccactttctttttacaccgctgttgtgtagcacaacc
gtaggaacgttggaatttcgaagtatcatcgagccggtgagaaacactggctttagagac
gagcatcactttcaacaagcagaggccgtagagttgcttccagatgaacacacggtggtc
tgcaagagtactttgaacggtgatcgatacgatttgaagtacgataaactggtcattggc
gtaggagctgttagcaatacatttggcgttccgggcgtttacgatcatgccttctttctc
aaggaaatttcggatgcaaggatgatcaggaatcaaattctcaaaaattttgaattggcc
atgcagcccggcgtcagcgaagaagagaaaaagcgcctgctacattttgtcatagttggg
ggtggccccactggggtggagtttggtgctgagttgtatgactttgtgaaacaagatgtg
acaaggctgtatgttcatgagcgcagcaatgtgagagtgactctgattgaggcaaggcag
atcctgccatcttttgatgaaaaactcagaacctttgcagaaagcaagatgagacagaga
gatcagtttgaacttctccagagcagtgtaactcaagtatgtgctgatcacattcagttg
aaagatggagaaaaattgccttgtggtttggtggtgtggtcaactggccttgctccaagg
ccattcactgcttcagttaaactacccaagaacaacaacagtcagctggtagttgataag
tttctcagagtccaaggaattgatgatggctcaatatttgcaattggcgactgctccttt
attgaggccaatccatacccctgcactgcccaggtagcagagagggagggcagctatgtg
gccaaatccctggggctctcagctcaagggaggggctcagaggtggagcccttttcctgg
aggaacattggtatgctggcttatcttggagattatcaaggactggctgattttcccaca
agcaagttgcaaggctttaaatcatggattctttggagatcagtgtactttaccaaactt
gggagctggaggttgagatttcaggtaccttttgattggatgagaaccttcatttggggc
agagatgtttctcagttttga

DBGET integrated database retrieval system