GenomeNet

Database: PDB
Entry: 5ZCS
LinkDB: 5ZCS
Original site: 5ZCS 
HEADER    GENE REGULATION                         20-FEB-18   5ZCS              
TITLE     4.9 ANGSTROM CRYO-EM STRUCTURE OF HUMAN MTOR COMPLEX 2                
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: SERINE/THREONINE-PROTEIN KINASE MTOR;                      
COMPND   3 CHAIN: A, B;                                                         
COMPND   4 SYNONYM: FK506-BINDING PROTEIN 12-RAPAMYCIN COMPLEX-ASSOCIATED       
COMPND   5 PROTEIN 1,FKBP12-RAPAMYCIN COMPLEX-ASSOCIATED PROTEIN,MAMMALIAN      
COMPND   6 TARGET OF RAPAMYCIN,MTOR,MECHANISTIC TARGET OF RAPAMYCIN,RAPAMYCIN   
COMPND   7 AND FKBP12 TARGET 1,RAPAMYCIN TARGET PROTEIN 1;                      
COMPND   8 EC: 2.7.11.1;                                                        
COMPND   9 ENGINEERED: YES;                                                     
COMPND  10 MOL_ID: 2;                                                           
COMPND  11 MOLECULE: TARGET OF RAPAMYCIN COMPLEX SUBUNIT LST8;                  
COMPND  12 CHAIN: C, D;                                                         
COMPND  13 SYNONYM: TORC SUBUNIT LST8,G PROTEIN BETA SUBUNIT-LIKE,PROTEIN       
COMPND  14 GBETAL,MAMMALIAN LETHAL WITH SEC13 PROTEIN 8,MLST8;                  
COMPND  15 ENGINEERED: YES;                                                     
COMPND  16 MOL_ID: 3;                                                           
COMPND  17 MOLECULE: RAPAMYCIN-INSENSITIVE COMPANION OF MTOR;                   
COMPND  18 CHAIN: E, F;                                                         
COMPND  19 SYNONYM: AVO3 HOMOLOG,HAVO3;                                         
COMPND  20 ENGINEERED: YES;                                                     
COMPND  21 MOL_ID: 4;                                                           
COMPND  22 MOLECULE: TARGET OF RAPAMYCIN COMPLEX 2 SUBUNIT MAPKAP1;             
COMPND  23 CHAIN: G, H;                                                         
COMPND  24 SYNONYM: SIN:STRESS-ACTIVATED MAP KINASE-INTERACTING PROTEIN 1,TORC2 
COMPND  25 SUBUNIT MAPKAP1,MITOGEN-ACTIVATED PROTEIN KINASE 2-ASSOCIATED PROTEIN
COMPND  26 1,STRESS-ACTIVATED MAP KINASE-INTERACTING PROTEIN 1,MSIN1;           
COMPND  27 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: MTOR, FRAP, FRAP1, FRAP2, RAFT1, RAPT1;                        
SOURCE   6 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE   7 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE   8 EXPRESSION_SYSTEM_CELL_LINE: 293F;                                   
SOURCE   9 MOL_ID: 2;                                                           
SOURCE  10 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  11 ORGANISM_COMMON: HUMAN;                                              
SOURCE  12 ORGANISM_TAXID: 9606;                                                
SOURCE  13 GENE: MLST8, GBL, LST8;                                              
SOURCE  14 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE  15 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE  16 EXPRESSION_SYSTEM_CELL_LINE: 293F;                                   
SOURCE  17 MOL_ID: 3;                                                           
SOURCE  18 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  19 ORGANISM_COMMON: HUMAN;                                              
SOURCE  20 ORGANISM_TAXID: 9606;                                                
SOURCE  21 GENE: RICTOR, KIAA1999;                                              
SOURCE  22 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE  23 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE  24 EXPRESSION_SYSTEM_CELL_LINE: 293F;                                   
SOURCE  25 MOL_ID: 4;                                                           
SOURCE  26 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  27 ORGANISM_COMMON: HUMAN;                                              
SOURCE  28 ORGANISM_TAXID: 9606;                                                
SOURCE  29 GENE: MAPKAP1, MIP1, SIN1;                                           
SOURCE  30 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE  31 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE  32 EXPRESSION_SYSTEM_CELL_LINE: 293F                                    
KEYWDS    CRYO-EM STRUCTURE HUMAN MTORC2, GENE REGULATION                       
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    X.CHEN,M.LIU,Y.TIAN,H.WANG,J.WANG,Y.XU                                
REVDAT   4   06-NOV-19 5ZCS    1       CRYST1 SCALE                             
REVDAT   3   30-MAY-18 5ZCS    1       JRNL                                     
REVDAT   2   04-APR-18 5ZCS    1       JRNL                                     
REVDAT   1   21-MAR-18 5ZCS    0                                                
JRNL        AUTH   X.CHEN,M.LIU,Y.TIAN,J.LI,Y.QI,D.ZHAO,Z.WU,M.HUANG,           
JRNL        AUTH 2 C.C.L.WONG,H.W.WANG,J.WANG,H.YANG,Y.XU                       
JRNL        TITL   CRYO-EM STRUCTURE OF HUMAN MTOR COMPLEX 2.                   
JRNL        REF    CELL RES.                     V.  28   518 2018              
JRNL        REFN                   ISSN 1748-7838                               
JRNL        PMID   29567957                                                     
JRNL        DOI    10.1038/S41422-018-0029-3                                    
REMARK   2                                                                      
REMARK   2 RESOLUTION.    4.90 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : SERIALEM, CTFFIND, UCSF CHIMERA,          
REMARK   3                            RELION, RELION, PHENIX                    
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : NULL                                
REMARK   3   REFINEMENT SPACE             : REAL                                
REMARK   3   REFINEMENT PROTOCOL          : OTHER                               
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 4.900                          
REMARK   3   NUMBER OF PARTICLES               : 195353                         
REMARK   3   CTF CORRECTION METHOD             : NONE                           
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 5ZCS COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY PDBJ ON 01-MAR-18.                  
REMARK 100 THE DEPOSITION ID IS D_1300006642.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : HUMAN MTOR COMPLEX 2              
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 1.50                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.40                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : GATAN K2 SUMMIT (4K X 4K)      
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : 2.70                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 50.00                          
REMARK 245   ILLUMINATION MODE                 : FLOOD BEAM                     
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: OCTAMERIC                         
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E, F, G, H                
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     MET A     1                                                      
REMARK 465     LEU A     2                                                      
REMARK 465     GLY A     3                                                      
REMARK 465     THR A     4                                                      
REMARK 465     GLY A     5                                                      
REMARK 465     PRO A     6                                                      
REMARK 465     ALA A     7                                                      
REMARK 465     ALA A     8                                                      
REMARK 465     ALA A     9                                                      
REMARK 465     THR A    10                                                      
REMARK 465     THR A    11                                                      
REMARK 465     ALA A    12                                                      
REMARK 465     ALA A    13                                                      
REMARK 465     THR A    14                                                      
REMARK 465     THR A    15                                                      
REMARK 465     SER A    16                                                      
REMARK 465     SER A    31                                                      
REMARK 465     ARG A    32                                                      
REMARK 465     ASN A    33                                                      
REMARK 465     GLU A    34                                                      
REMARK 465     GLU A    35                                                      
REMARK 465     THR A    36                                                      
REMARK 465     GLU A    54                                                      
REMARK 465     MET A    55                                                      
REMARK 465     SER A    56                                                      
REMARK 465     GLN A    57                                                      
REMARK 465     GLU A    58                                                      
REMARK 465     GLU A    59                                                      
REMARK 465     VAL A    75                                                      
REMARK 465     SER A    76                                                      
REMARK 465     SER A    77                                                      
REMARK 465     SER A    78                                                      
REMARK 465     ASP A    79                                                      
REMARK 465     ALA A    80                                                      
REMARK 465     ASN A    81                                                      
REMARK 465     GLY A   157                                                      
REMARK 465     ALA A   158                                                      
REMARK 465     ASP A   159                                                      
REMARK 465     ARG A   160                                                      
REMARK 465     ASN A   161                                                      
REMARK 465     GLU A   224                                                      
REMARK 465     PRO A   225                                                      
REMARK 465     LYS A   226                                                      
REMARK 465     GLU A   227                                                      
REMARK 465     MET A   228                                                      
REMARK 465     GLN A   229                                                      
REMARK 465     LYS A   230                                                      
REMARK 465     PRO A   231                                                      
REMARK 465     GLN A   232                                                      
REMARK 465     GLU A   247                                                      
REMARK 465     THR A   248                                                      
REMARK 465     LEU A   249                                                      
REMARK 465     ALA A   250                                                      
REMARK 465     LYS A   251                                                      
REMARK 465     GLU A   252                                                      
REMARK 465     LYS A   253                                                      
REMARK 465     GLY A   254                                                      
REMARK 465     MET A   255                                                      
REMARK 465     ASN A   256                                                      
REMARK 465     ARG A   257                                                      
REMARK 465     THR A   290                                                      
REMARK 465     GLN A   291                                                      
REMARK 465     GLN A   292                                                      
REMARK 465     GLN A   293                                                      
REMARK 465     LEU A   294                                                      
REMARK 465     VAL A   295                                                      
REMARK 465     HIS A   296                                                      
REMARK 465     ASP A   297                                                      
REMARK 465     LYS A   298                                                      
REMARK 465     TYR A   299                                                      
REMARK 465     CYS A   300                                                      
REMARK 465     LYS A   301                                                      
REMARK 465     ASP A   302                                                      
REMARK 465     LEU A   303                                                      
REMARK 465     MET A   304                                                      
REMARK 465     GLY A   305                                                      
REMARK 465     PHE A   306                                                      
REMARK 465     GLY A   307                                                      
REMARK 465     THR A   308                                                      
REMARK 465     LYS A   309                                                      
REMARK 465     PRO A   310                                                      
REMARK 465     ARG A   311                                                      
REMARK 465     HIS A   312                                                      
REMARK 465     ILE A   313                                                      
REMARK 465     THR A   314                                                      
REMARK 465     PRO A   315                                                      
REMARK 465     PHE A   316                                                      
REMARK 465     THR A   317                                                      
REMARK 465     SER A   318                                                      
REMARK 465     PHE A   319                                                      
REMARK 465     GLN A   320                                                      
REMARK 465     ALA A   321                                                      
REMARK 465     VAL A   322                                                      
REMARK 465     GLN A   323                                                      
REMARK 465     PRO A   324                                                      
REMARK 465     GLN A   325                                                      
REMARK 465     GLN A   326                                                      
REMARK 465     SER A   327                                                      
REMARK 465     ASN A   328                                                      
REMARK 465     ALA A   329                                                      
REMARK 465     LEU A   330                                                      
REMARK 465     VAL A   331                                                      
REMARK 465     GLY A   332                                                      
REMARK 465     LEU A   333                                                      
REMARK 465     LEU A   334                                                      
REMARK 465     GLY A   335                                                      
REMARK 465     TYR A   336                                                      
REMARK 465     SER A   337                                                      
REMARK 465     SER A   338                                                      
REMARK 465     HIS A   339                                                      
REMARK 465     GLN A   340                                                      
REMARK 465     GLY A   341                                                      
REMARK 465     LEU A   342                                                      
REMARK 465     MET A   343                                                      
REMARK 465     GLY A   344                                                      
REMARK 465     PHE A   345                                                      
REMARK 465     GLY A   346                                                      
REMARK 465     THR A   347                                                      
REMARK 465     SER A   348                                                      
REMARK 465     PRO A   349                                                      
REMARK 465     SER A   350                                                      
REMARK 465     PRO A   351                                                      
REMARK 465     ALA A   352                                                      
REMARK 465     LYS A   353                                                      
REMARK 465     SER A   354                                                      
REMARK 465     THR A   355                                                      
REMARK 465     ARG A   381                                                      
REMARK 465     ASN A   382                                                      
REMARK 465     SER A   383                                                      
REMARK 465     LYS A   384                                                      
REMARK 465     ASN A   385                                                      
REMARK 465     SER A   405                                                      
REMARK 465     ALA A   406                                                      
REMARK 465     PHE A   407                                                      
REMARK 465     THR A   408                                                      
REMARK 465     ASP A   409                                                      
REMARK 465     ASP A   467                                                      
REMARK 465     PHE A   468                                                      
REMARK 465     ALA A   469                                                      
REMARK 465     HIS A   470                                                      
REMARK 465     LYS A   471                                                      
REMARK 465     ARG A   472                                                      
REMARK 465     GLN A   473                                                      
REMARK 465     LYS A   474                                                      
REMARK 465     ALA A   475                                                      
REMARK 465     MET A   476                                                      
REMARK 465     GLN A   477                                                      
REMARK 465     ALA A   492                                                      
REMARK 465     MET A   493                                                      
REMARK 465     GLY A   494                                                      
REMARK 465     PRO A   495                                                      
REMARK 465     GLY A   496                                                      
REMARK 465     LYS A   550                                                      
REMARK 465     PRO A   551                                                      
REMARK 465     LEU A   552                                                      
REMARK 465     ARG A   553                                                      
REMARK 465     HIS A   554                                                      
REMARK 465     PRO A   555                                                      
REMARK 465     GLY A   556                                                      
REMARK 465     MET A   557                                                      
REMARK 465     PRO A   558                                                      
REMARK 465     LYS A   559                                                      
REMARK 465     GLY A   560                                                      
REMARK 465     LEU A   561                                                      
REMARK 465     ALA A   562                                                      
REMARK 465     HIS A   563                                                      
REMARK 465     GLN A   564                                                      
REMARK 465     LEU A   565                                                      
REMARK 465     ALA A   566                                                      
REMARK 465     SER A   567                                                      
REMARK 465     PRO A   568                                                      
REMARK 465     GLY A   569                                                      
REMARK 465     LEU A   570                                                      
REMARK 465     THR A   571                                                      
REMARK 465     THR A   572                                                      
REMARK 465     LEU A   573                                                      
REMARK 465     PRO A   574                                                      
REMARK 465     GLU A   575                                                      
REMARK 465     ALA A   576                                                      
REMARK 465     SER A   577                                                      
REMARK 465     GLY A   596                                                      
REMARK 465     HIS A   597                                                      
REMARK 465     SER A   598                                                      
REMARK 465     ILE A   634                                                      
REMARK 465     HIS A   635                                                      
REMARK 465     LEU A   636                                                      
REMARK 465     ILE A   637                                                      
REMARK 465     SER A   638                                                      
REMARK 465     GLY A   639                                                      
REMARK 465     HIS A   640                                                      
REMARK 465     ALA A   641                                                      
REMARK 465     HIS A   642                                                      
REMARK 465     VAL A   643                                                      
REMARK 465     ASP A   787                                                      
REMARK 465     PRO A   788                                                      
REMARK 465     ASP A   789                                                      
REMARK 465     PRO A   790                                                      
REMARK 465     GLY A   904                                                      
REMARK 465     MET A   905                                                      
REMARK 465     ILE A   906                                                      
REMARK 465     ASP A   907                                                      
REMARK 465     GLN A   908                                                      
REMARK 465     SER A   909                                                      
REMARK 465     ARG A   910                                                      
REMARK 465     ASP A   911                                                      
REMARK 465     ALA A   912                                                      
REMARK 465     SER A   913                                                      
REMARK 465     ALA A   914                                                      
REMARK 465     VAL A   915                                                      
REMARK 465     SER A   916                                                      
REMARK 465     LEU A   917                                                      
REMARK 465     SER A   918                                                      
REMARK 465     GLU A   919                                                      
REMARK 465     SER A   920                                                      
REMARK 465     LYS A   921                                                      
REMARK 465     SER A   922                                                      
REMARK 465     SER A   923                                                      
REMARK 465     GLN A   924                                                      
REMARK 465     ASP A   925                                                      
REMARK 465     SER A   926                                                      
REMARK 465     SER A   927                                                      
REMARK 465     ASP A   928                                                      
REMARK 465     TYR A   929                                                      
REMARK 465     SER A   930                                                      
REMARK 465     THR A   931                                                      
REMARK 465     SER A   932                                                      
REMARK 465     ALA A  1223                                                      
REMARK 465     ASP A  1224                                                      
REMARK 465     GLU A  1225                                                      
REMARK 465     GLU A  1226                                                      
REMARK 465     GLU A  1227                                                      
REMARK 465     ASP A  1228                                                      
REMARK 465     PRO A  1229                                                      
REMARK 465     LEU A  1230                                                      
REMARK 465     ILE A  1231                                                      
REMARK 465     TYR A  1232                                                      
REMARK 465     GLN A  1233                                                      
REMARK 465     HIS A  1234                                                      
REMARK 465     ARG A  1235                                                      
REMARK 465     MET A  1236                                                      
REMARK 465     LEU A  1237                                                      
REMARK 465     ARG A  1238                                                      
REMARK 465     SER A  1239                                                      
REMARK 465     GLY A  1240                                                      
REMARK 465     GLN A  1241                                                      
REMARK 465     GLY A  1242                                                      
REMARK 465     ASP A  1243                                                      
REMARK 465     ALA A  1244                                                      
REMARK 465     LEU A  1245                                                      
REMARK 465     ALA A  1246                                                      
REMARK 465     SER A  1247                                                      
REMARK 465     GLY A  1248                                                      
REMARK 465     PRO A  1249                                                      
REMARK 465     VAL A  1250                                                      
REMARK 465     GLU A  1251                                                      
REMARK 465     THR A  1252                                                      
REMARK 465     GLY A  1253                                                      
REMARK 465     PRO A  1254                                                      
REMARK 465     MET A  1255                                                      
REMARK 465     LYS A  1256                                                      
REMARK 465     LYS A  1257                                                      
REMARK 465     LEU A  1258                                                      
REMARK 465     HIS A  1259                                                      
REMARK 465     VAL A  1260                                                      
REMARK 465     LYS A  1815                                                      
REMARK 465     LYS A  1816                                                      
REMARK 465     LEU A  1817                                                      
REMARK 465     ARG A  1818                                                      
REMARK 465     HIS A  1819                                                      
REMARK 465     ALA A  1820                                                      
REMARK 465     SER A  1821                                                      
REMARK 465     GLY A  1822                                                      
REMARK 465     ALA A  1823                                                      
REMARK 465     ASN A  1824                                                      
REMARK 465     ILE A  1825                                                      
REMARK 465     THR A  1826                                                      
REMARK 465     ASN A  1827                                                      
REMARK 465     ALA A  1828                                                      
REMARK 465     THR A  1829                                                      
REMARK 465     THR A  1830                                                      
REMARK 465     ALA A  1831                                                      
REMARK 465     ALA A  1832                                                      
REMARK 465     THR A  1833                                                      
REMARK 465     THR A  1834                                                      
REMARK 465     ALA A  1835                                                      
REMARK 465     ALA A  1836                                                      
REMARK 465     THR A  1837                                                      
REMARK 465     ALA A  1838                                                      
REMARK 465     THR A  1839                                                      
REMARK 465     THR A  1840                                                      
REMARK 465     THR A  1841                                                      
REMARK 465     ALA A  1842                                                      
REMARK 465     SER A  1843                                                      
REMARK 465     THR A  1844                                                      
REMARK 465     GLU A  1845                                                      
REMARK 465     GLY A  1846                                                      
REMARK 465     SER A  1847                                                      
REMARK 465     ASN A  1848                                                      
REMARK 465     SER A  1849                                                      
REMARK 465     GLU A  1850                                                      
REMARK 465     SER A  1851                                                      
REMARK 465     GLU A  1852                                                      
REMARK 465     ALA A  1853                                                      
REMARK 465     GLU A  1854                                                      
REMARK 465     SER A  1855                                                      
REMARK 465     THR A  1856                                                      
REMARK 465     GLU A  1857                                                      
REMARK 465     ASN A  1858                                                      
REMARK 465     SER A  1859                                                      
REMARK 465     PRO A  1860                                                      
REMARK 465     THR A  1861                                                      
REMARK 465     PRO A  1862                                                      
REMARK 465     SER A  1863                                                      
REMARK 465     PRO A  1864                                                      
REMARK 465     LEU A  1865                                                      
REMARK 465     GLN A  1866                                                      
REMARK 465     LYS A  2437                                                      
REMARK 465     GLY A  2438                                                      
REMARK 465     ASN A  2439                                                      
REMARK 465     LYS A  2440                                                      
REMARK 465     ARG A  2441                                                      
REMARK 465     SER A  2442                                                      
REMARK 465     ARG A  2443                                                      
REMARK 465     THR A  2444                                                      
REMARK 465     ARG A  2445                                                      
REMARK 465     THR A  2446                                                      
REMARK 465     ASP A  2447                                                      
REMARK 465     SER A  2448                                                      
REMARK 465     TYR A  2449                                                      
REMARK 465     SER A  2450                                                      
REMARK 465     ALA A  2451                                                      
REMARK 465     GLY A  2452                                                      
REMARK 465     GLN A  2453                                                      
REMARK 465     SER A  2454                                                      
REMARK 465     VAL A  2455                                                      
REMARK 465     GLU A  2456                                                      
REMARK 465     ILE A  2457                                                      
REMARK 465     LEU A  2458                                                      
REMARK 465     ASP A  2459                                                      
REMARK 465     GLY A  2460                                                      
REMARK 465     VAL A  2461                                                      
REMARK 465     GLU A  2462                                                      
REMARK 465     LEU A  2463                                                      
REMARK 465     GLY A  2464                                                      
REMARK 465     GLU A  2465                                                      
REMARK 465     PRO A  2466                                                      
REMARK 465     ALA A  2467                                                      
REMARK 465     HIS A  2468                                                      
REMARK 465     LYS A  2469                                                      
REMARK 465     LYS A  2470                                                      
REMARK 465     THR A  2471                                                      
REMARK 465     GLY A  2472                                                      
REMARK 465     THR A  2473                                                      
REMARK 465     THR A  2474                                                      
REMARK 465     VAL A  2475                                                      
REMARK 465     PRO A  2476                                                      
REMARK 465     GLU A  2477                                                      
REMARK 465     SER A  2478                                                      
REMARK 465     ILE A  2479                                                      
REMARK 465     HIS A  2480                                                      
REMARK 465     SER A  2481                                                      
REMARK 465     PHE A  2482                                                      
REMARK 465     ILE A  2483                                                      
REMARK 465     GLY A  2484                                                      
REMARK 465     ASP A  2485                                                      
REMARK 465     GLY A  2486                                                      
REMARK 465     LEU A  2487                                                      
REMARK 465     VAL A  2488                                                      
REMARK 465     LYS A  2489                                                      
REMARK 465     PRO A  2490                                                      
REMARK 465     GLU A  2491                                                      
REMARK 465     MET B     1                                                      
REMARK 465     LEU B     2                                                      
REMARK 465     GLY B     3                                                      
REMARK 465     THR B     4                                                      
REMARK 465     GLY B     5                                                      
REMARK 465     PRO B     6                                                      
REMARK 465     ALA B     7                                                      
REMARK 465     ALA B     8                                                      
REMARK 465     ALA B     9                                                      
REMARK 465     THR B    10                                                      
REMARK 465     THR B    11                                                      
REMARK 465     ALA B    12                                                      
REMARK 465     ALA B    13                                                      
REMARK 465     THR B    14                                                      
REMARK 465     THR B    15                                                      
REMARK 465     SER B    16                                                      
REMARK 465     SER B    31                                                      
REMARK 465     ARG B    32                                                      
REMARK 465     ASN B    33                                                      
REMARK 465     GLU B    34                                                      
REMARK 465     GLU B    35                                                      
REMARK 465     THR B    36                                                      
REMARK 465     GLU B    54                                                      
REMARK 465     MET B    55                                                      
REMARK 465     SER B    56                                                      
REMARK 465     GLN B    57                                                      
REMARK 465     GLU B    58                                                      
REMARK 465     GLU B    59                                                      
REMARK 465     VAL B    75                                                      
REMARK 465     SER B    76                                                      
REMARK 465     SER B    77                                                      
REMARK 465     SER B    78                                                      
REMARK 465     ASP B    79                                                      
REMARK 465     ALA B    80                                                      
REMARK 465     ASN B    81                                                      
REMARK 465     GLY B   157                                                      
REMARK 465     ALA B   158                                                      
REMARK 465     ASP B   159                                                      
REMARK 465     ARG B   160                                                      
REMARK 465     ASN B   161                                                      
REMARK 465     GLU B   224                                                      
REMARK 465     PRO B   225                                                      
REMARK 465     LYS B   226                                                      
REMARK 465     GLU B   227                                                      
REMARK 465     MET B   228                                                      
REMARK 465     GLN B   229                                                      
REMARK 465     LYS B   230                                                      
REMARK 465     PRO B   231                                                      
REMARK 465     GLN B   232                                                      
REMARK 465     GLU B   247                                                      
REMARK 465     THR B   248                                                      
REMARK 465     LEU B   249                                                      
REMARK 465     ALA B   250                                                      
REMARK 465     LYS B   251                                                      
REMARK 465     GLU B   252                                                      
REMARK 465     LYS B   253                                                      
REMARK 465     GLY B   254                                                      
REMARK 465     MET B   255                                                      
REMARK 465     ASN B   256                                                      
REMARK 465     ARG B   257                                                      
REMARK 465     THR B   290                                                      
REMARK 465     GLN B   291                                                      
REMARK 465     GLN B   292                                                      
REMARK 465     GLN B   293                                                      
REMARK 465     LEU B   294                                                      
REMARK 465     VAL B   295                                                      
REMARK 465     HIS B   296                                                      
REMARK 465     ASP B   297                                                      
REMARK 465     LYS B   298                                                      
REMARK 465     TYR B   299                                                      
REMARK 465     CYS B   300                                                      
REMARK 465     LYS B   301                                                      
REMARK 465     ASP B   302                                                      
REMARK 465     LEU B   303                                                      
REMARK 465     MET B   304                                                      
REMARK 465     GLY B   305                                                      
REMARK 465     PHE B   306                                                      
REMARK 465     GLY B   307                                                      
REMARK 465     THR B   308                                                      
REMARK 465     LYS B   309                                                      
REMARK 465     PRO B   310                                                      
REMARK 465     ARG B   311                                                      
REMARK 465     HIS B   312                                                      
REMARK 465     ILE B   313                                                      
REMARK 465     THR B   314                                                      
REMARK 465     PRO B   315                                                      
REMARK 465     PHE B   316                                                      
REMARK 465     THR B   317                                                      
REMARK 465     SER B   318                                                      
REMARK 465     PHE B   319                                                      
REMARK 465     GLN B   320                                                      
REMARK 465     ALA B   321                                                      
REMARK 465     VAL B   322                                                      
REMARK 465     GLN B   323                                                      
REMARK 465     PRO B   324                                                      
REMARK 465     GLN B   325                                                      
REMARK 465     GLN B   326                                                      
REMARK 465     SER B   327                                                      
REMARK 465     ASN B   328                                                      
REMARK 465     ALA B   329                                                      
REMARK 465     LEU B   330                                                      
REMARK 465     VAL B   331                                                      
REMARK 465     GLY B   332                                                      
REMARK 465     LEU B   333                                                      
REMARK 465     LEU B   334                                                      
REMARK 465     GLY B   335                                                      
REMARK 465     TYR B   336                                                      
REMARK 465     SER B   337                                                      
REMARK 465     SER B   338                                                      
REMARK 465     HIS B   339                                                      
REMARK 465     GLN B   340                                                      
REMARK 465     GLY B   341                                                      
REMARK 465     LEU B   342                                                      
REMARK 465     MET B   343                                                      
REMARK 465     GLY B   344                                                      
REMARK 465     PHE B   345                                                      
REMARK 465     GLY B   346                                                      
REMARK 465     THR B   347                                                      
REMARK 465     SER B   348                                                      
REMARK 465     PRO B   349                                                      
REMARK 465     SER B   350                                                      
REMARK 465     PRO B   351                                                      
REMARK 465     ALA B   352                                                      
REMARK 465     LYS B   353                                                      
REMARK 465     SER B   354                                                      
REMARK 465     THR B   355                                                      
REMARK 465     ARG B   381                                                      
REMARK 465     ASN B   382                                                      
REMARK 465     SER B   383                                                      
REMARK 465     LYS B   384                                                      
REMARK 465     ASN B   385                                                      
REMARK 465     SER B   405                                                      
REMARK 465     ALA B   406                                                      
REMARK 465     PHE B   407                                                      
REMARK 465     THR B   408                                                      
REMARK 465     ASP B   409                                                      
REMARK 465     ASP B   467                                                      
REMARK 465     PHE B   468                                                      
REMARK 465     ALA B   469                                                      
REMARK 465     HIS B   470                                                      
REMARK 465     LYS B   471                                                      
REMARK 465     ARG B   472                                                      
REMARK 465     GLN B   473                                                      
REMARK 465     LYS B   474                                                      
REMARK 465     ALA B   475                                                      
REMARK 465     MET B   476                                                      
REMARK 465     GLN B   477                                                      
REMARK 465     ALA B   492                                                      
REMARK 465     MET B   493                                                      
REMARK 465     GLY B   494                                                      
REMARK 465     PRO B   495                                                      
REMARK 465     GLY B   496                                                      
REMARK 465     LYS B   550                                                      
REMARK 465     PRO B   551                                                      
REMARK 465     LEU B   552                                                      
REMARK 465     ARG B   553                                                      
REMARK 465     HIS B   554                                                      
REMARK 465     PRO B   555                                                      
REMARK 465     GLY B   556                                                      
REMARK 465     MET B   557                                                      
REMARK 465     PRO B   558                                                      
REMARK 465     LYS B   559                                                      
REMARK 465     GLY B   560                                                      
REMARK 465     LEU B   561                                                      
REMARK 465     ALA B   562                                                      
REMARK 465     HIS B   563                                                      
REMARK 465     GLN B   564                                                      
REMARK 465     LEU B   565                                                      
REMARK 465     ALA B   566                                                      
REMARK 465     SER B   567                                                      
REMARK 465     PRO B   568                                                      
REMARK 465     GLY B   569                                                      
REMARK 465     LEU B   570                                                      
REMARK 465     THR B   571                                                      
REMARK 465     THR B   572                                                      
REMARK 465     LEU B   573                                                      
REMARK 465     PRO B   574                                                      
REMARK 465     GLU B   575                                                      
REMARK 465     ALA B   576                                                      
REMARK 465     SER B   577                                                      
REMARK 465     GLY B   596                                                      
REMARK 465     HIS B   597                                                      
REMARK 465     SER B   598                                                      
REMARK 465     ILE B   634                                                      
REMARK 465     HIS B   635                                                      
REMARK 465     LEU B   636                                                      
REMARK 465     ILE B   637                                                      
REMARK 465     SER B   638                                                      
REMARK 465     GLY B   639                                                      
REMARK 465     HIS B   640                                                      
REMARK 465     ALA B   641                                                      
REMARK 465     HIS B   642                                                      
REMARK 465     VAL B   643                                                      
REMARK 465     ASP B   787                                                      
REMARK 465     PRO B   788                                                      
REMARK 465     ASP B   789                                                      
REMARK 465     PRO B   790                                                      
REMARK 465     GLY B   904                                                      
REMARK 465     MET B   905                                                      
REMARK 465     ILE B   906                                                      
REMARK 465     ASP B   907                                                      
REMARK 465     GLN B   908                                                      
REMARK 465     SER B   909                                                      
REMARK 465     ARG B   910                                                      
REMARK 465     ASP B   911                                                      
REMARK 465     ALA B   912                                                      
REMARK 465     SER B   913                                                      
REMARK 465     ALA B   914                                                      
REMARK 465     VAL B   915                                                      
REMARK 465     SER B   916                                                      
REMARK 465     LEU B   917                                                      
REMARK 465     SER B   918                                                      
REMARK 465     GLU B   919                                                      
REMARK 465     SER B   920                                                      
REMARK 465     LYS B   921                                                      
REMARK 465     SER B   922                                                      
REMARK 465     SER B   923                                                      
REMARK 465     GLN B   924                                                      
REMARK 465     ASP B   925                                                      
REMARK 465     SER B   926                                                      
REMARK 465     SER B   927                                                      
REMARK 465     ASP B   928                                                      
REMARK 465     TYR B   929                                                      
REMARK 465     SER B   930                                                      
REMARK 465     THR B   931                                                      
REMARK 465     SER B   932                                                      
REMARK 465     ALA B  1223                                                      
REMARK 465     ASP B  1224                                                      
REMARK 465     GLU B  1225                                                      
REMARK 465     GLU B  1226                                                      
REMARK 465     GLU B  1227                                                      
REMARK 465     ASP B  1228                                                      
REMARK 465     PRO B  1229                                                      
REMARK 465     LEU B  1230                                                      
REMARK 465     ILE B  1231                                                      
REMARK 465     TYR B  1232                                                      
REMARK 465     GLN B  1233                                                      
REMARK 465     HIS B  1234                                                      
REMARK 465     ARG B  1235                                                      
REMARK 465     MET B  1236                                                      
REMARK 465     LEU B  1237                                                      
REMARK 465     ARG B  1238                                                      
REMARK 465     SER B  1239                                                      
REMARK 465     GLY B  1240                                                      
REMARK 465     GLN B  1241                                                      
REMARK 465     GLY B  1242                                                      
REMARK 465     ASP B  1243                                                      
REMARK 465     ALA B  1244                                                      
REMARK 465     LEU B  1245                                                      
REMARK 465     ALA B  1246                                                      
REMARK 465     SER B  1247                                                      
REMARK 465     GLY B  1248                                                      
REMARK 465     PRO B  1249                                                      
REMARK 465     VAL B  1250                                                      
REMARK 465     GLU B  1251                                                      
REMARK 465     THR B  1252                                                      
REMARK 465     GLY B  1253                                                      
REMARK 465     PRO B  1254                                                      
REMARK 465     MET B  1255                                                      
REMARK 465     LYS B  1256                                                      
REMARK 465     LYS B  1257                                                      
REMARK 465     LEU B  1258                                                      
REMARK 465     HIS B  1259                                                      
REMARK 465     VAL B  1260                                                      
REMARK 465     LYS B  1815                                                      
REMARK 465     LYS B  1816                                                      
REMARK 465     LEU B  1817                                                      
REMARK 465     ARG B  1818                                                      
REMARK 465     HIS B  1819                                                      
REMARK 465     ALA B  1820                                                      
REMARK 465     SER B  1821                                                      
REMARK 465     GLY B  1822                                                      
REMARK 465     ALA B  1823                                                      
REMARK 465     ASN B  1824                                                      
REMARK 465     ILE B  1825                                                      
REMARK 465     THR B  1826                                                      
REMARK 465     ASN B  1827                                                      
REMARK 465     ALA B  1828                                                      
REMARK 465     THR B  1829                                                      
REMARK 465     THR B  1830                                                      
REMARK 465     ALA B  1831                                                      
REMARK 465     ALA B  1832                                                      
REMARK 465     THR B  1833                                                      
REMARK 465     THR B  1834                                                      
REMARK 465     ALA B  1835                                                      
REMARK 465     ALA B  1836                                                      
REMARK 465     THR B  1837                                                      
REMARK 465     ALA B  1838                                                      
REMARK 465     THR B  1839                                                      
REMARK 465     THR B  1840                                                      
REMARK 465     THR B  1841                                                      
REMARK 465     ALA B  1842                                                      
REMARK 465     SER B  1843                                                      
REMARK 465     THR B  1844                                                      
REMARK 465     GLU B  1845                                                      
REMARK 465     GLY B  1846                                                      
REMARK 465     SER B  1847                                                      
REMARK 465     ASN B  1848                                                      
REMARK 465     SER B  1849                                                      
REMARK 465     GLU B  1850                                                      
REMARK 465     SER B  1851                                                      
REMARK 465     GLU B  1852                                                      
REMARK 465     ALA B  1853                                                      
REMARK 465     GLU B  1854                                                      
REMARK 465     SER B  1855                                                      
REMARK 465     THR B  1856                                                      
REMARK 465     GLU B  1857                                                      
REMARK 465     ASN B  1858                                                      
REMARK 465     SER B  1859                                                      
REMARK 465     PRO B  1860                                                      
REMARK 465     THR B  1861                                                      
REMARK 465     PRO B  1862                                                      
REMARK 465     SER B  1863                                                      
REMARK 465     PRO B  1864                                                      
REMARK 465     LEU B  1865                                                      
REMARK 465     GLN B  1866                                                      
REMARK 465     LYS B  2437                                                      
REMARK 465     GLY B  2438                                                      
REMARK 465     ASN B  2439                                                      
REMARK 465     LYS B  2440                                                      
REMARK 465     ARG B  2441                                                      
REMARK 465     SER B  2442                                                      
REMARK 465     ARG B  2443                                                      
REMARK 465     THR B  2444                                                      
REMARK 465     ARG B  2445                                                      
REMARK 465     THR B  2446                                                      
REMARK 465     ASP B  2447                                                      
REMARK 465     SER B  2448                                                      
REMARK 465     TYR B  2449                                                      
REMARK 465     SER B  2450                                                      
REMARK 465     ALA B  2451                                                      
REMARK 465     GLY B  2452                                                      
REMARK 465     GLN B  2453                                                      
REMARK 465     SER B  2454                                                      
REMARK 465     VAL B  2455                                                      
REMARK 465     GLU B  2456                                                      
REMARK 465     ILE B  2457                                                      
REMARK 465     LEU B  2458                                                      
REMARK 465     ASP B  2459                                                      
REMARK 465     GLY B  2460                                                      
REMARK 465     VAL B  2461                                                      
REMARK 465     GLU B  2462                                                      
REMARK 465     LEU B  2463                                                      
REMARK 465     GLY B  2464                                                      
REMARK 465     GLU B  2465                                                      
REMARK 465     PRO B  2466                                                      
REMARK 465     ALA B  2467                                                      
REMARK 465     HIS B  2468                                                      
REMARK 465     LYS B  2469                                                      
REMARK 465     LYS B  2470                                                      
REMARK 465     THR B  2471                                                      
REMARK 465     GLY B  2472                                                      
REMARK 465     THR B  2473                                                      
REMARK 465     THR B  2474                                                      
REMARK 465     VAL B  2475                                                      
REMARK 465     PRO B  2476                                                      
REMARK 465     GLU B  2477                                                      
REMARK 465     SER B  2478                                                      
REMARK 465     ILE B  2479                                                      
REMARK 465     HIS B  2480                                                      
REMARK 465     SER B  2481                                                      
REMARK 465     PHE B  2482                                                      
REMARK 465     ILE B  2483                                                      
REMARK 465     GLY B  2484                                                      
REMARK 465     ASP B  2485                                                      
REMARK 465     GLY B  2486                                                      
REMARK 465     LEU B  2487                                                      
REMARK 465     VAL B  2488                                                      
REMARK 465     LYS B  2489                                                      
REMARK 465     PRO B  2490                                                      
REMARK 465     GLU B  2491                                                      
REMARK 465     MET C     1                                                      
REMARK 465     ASN C     2                                                      
REMARK 465     THR C     3                                                      
REMARK 465     SER C     4                                                      
REMARK 465     PRO C     5                                                      
REMARK 465     GLY C     6                                                      
REMARK 465     THR C     7                                                      
REMARK 465     LEU C   325                                                      
REMARK 465     GLY C   326                                                      
REMARK 465     MET D     1                                                      
REMARK 465     ASN D     2                                                      
REMARK 465     THR D     3                                                      
REMARK 465     SER D     4                                                      
REMARK 465     PRO D     5                                                      
REMARK 465     GLY D     6                                                      
REMARK 465     THR D     7                                                      
REMARK 465     LEU D   325                                                      
REMARK 465     GLY D   326                                                      
REMARK 465     MET E     1                                                      
REMARK 465     ALA E     2                                                      
REMARK 465     ALA E     3                                                      
REMARK 465     ILE E     4                                                      
REMARK 465     GLY E     5                                                      
REMARK 465     ARG E     6                                                      
REMARK 465     GLY E     7                                                      
REMARK 465     ARG E     8                                                      
REMARK 465     SER E     9                                                      
REMARK 465     LEU E    10                                                      
REMARK 465     LYS E    11                                                      
REMARK 465     ASN E    12                                                      
REMARK 465     LEU E    13                                                      
REMARK 465     ARG E    14                                                      
REMARK 465     VAL E    15                                                      
REMARK 465     ARG E    16                                                      
REMARK 465     GLY E    17                                                      
REMARK 465     ARG E    18                                                      
REMARK 465     ASN E    19                                                      
REMARK 465     ASP E    20                                                      
REMARK 465     SER E    21                                                      
REMARK 465     GLY E    22                                                      
REMARK 465     GLU E    23                                                      
REMARK 465     GLU E    24                                                      
REMARK 465     ASN E    25                                                      
REMARK 465     VAL E    26                                                      
REMARK 465     PRO E    27                                                      
REMARK 465     LEU E    28                                                      
REMARK 465     ASP E    29                                                      
REMARK 465     LEU E    30                                                      
REMARK 465     THR E    31                                                      
REMARK 465     ARG E    32                                                      
REMARK 465     GLU E    33                                                      
REMARK 465     PRO E    34                                                      
REMARK 465     SER E    35                                                      
REMARK 465     ASP E    36                                                      
REMARK 465     ASN E    37                                                      
REMARK 465     LEU E    38                                                      
REMARK 465     ARG E    39                                                      
REMARK 465     GLU E    40                                                      
REMARK 465     ILE E    41                                                      
REMARK 465     LEU E    42                                                      
REMARK 465     GLN E    43                                                      
REMARK 465     ASN E    44                                                      
REMARK 465     VAL E    45                                                      
REMARK 465     ALA E    46                                                      
REMARK 465     ARG E    47                                                      
REMARK 465     LEU E    48                                                      
REMARK 465     GLN E    49                                                      
REMARK 465     GLY E    50                                                      
REMARK 465     VAL E    51                                                      
REMARK 465     SER E    52                                                      
REMARK 465     ASN E    53                                                      
REMARK 465     MET E    54                                                      
REMARK 465     ARG E    55                                                      
REMARK 465     LYS E    56                                                      
REMARK 465     LEU E    57                                                      
REMARK 465     GLY E    58                                                      
REMARK 465     HIS E    59                                                      
REMARK 465     LEU E    60                                                      
REMARK 465     ASN E    61                                                      
REMARK 465     ASN E    62                                                      
REMARK 465     PHE E    63                                                      
REMARK 465     THR E    64                                                      
REMARK 465     LYS E    65                                                      
REMARK 465     LEU E    66                                                      
REMARK 465     LEU E    67                                                      
REMARK 465     CYS E    68                                                      
REMARK 465     ASP E    69                                                      
REMARK 465     ILE E    70                                                      
REMARK 465     GLY E    71                                                      
REMARK 465     HIS E    72                                                      
REMARK 465     SER E    73                                                      
REMARK 465     GLU E    74                                                      
REMARK 465     GLU E    75                                                      
REMARK 465     LYS E    76                                                      
REMARK 465     LEU E    77                                                      
REMARK 465     GLY E    78                                                      
REMARK 465     PHE E    79                                                      
REMARK 465     HIS E    80                                                      
REMARK 465     TYR E    81                                                      
REMARK 465     GLU E    82                                                      
REMARK 465     ASP E    83                                                      
REMARK 465     ILE E    84                                                      
REMARK 465     ILE E    85                                                      
REMARK 465     ILE E    86                                                      
REMARK 465     CYS E    87                                                      
REMARK 465     LEU E    88                                                      
REMARK 465     ARG E    89                                                      
REMARK 465     LEU E    90                                                      
REMARK 465     ALA E    91                                                      
REMARK 465     LEU E    92                                                      
REMARK 465     LEU E    93                                                      
REMARK 465     ASN E    94                                                      
REMARK 465     GLU E    95                                                      
REMARK 465     ALA E    96                                                      
REMARK 465     LYS E    97                                                      
REMARK 465     GLU E    98                                                      
REMARK 465     VAL E    99                                                      
REMARK 465     ARG E   100                                                      
REMARK 465     ALA E   101                                                      
REMARK 465     ALA E   102                                                      
REMARK 465     GLY E   103                                                      
REMARK 465     LEU E   104                                                      
REMARK 465     ARG E   105                                                      
REMARK 465     ALA E   106                                                      
REMARK 465     LEU E   107                                                      
REMARK 465     ARG E   108                                                      
REMARK 465     TYR E   109                                                      
REMARK 465     LEU E   110                                                      
REMARK 465     ILE E   111                                                      
REMARK 465     GLN E   112                                                      
REMARK 465     ASP E   113                                                      
REMARK 465     SER E   114                                                      
REMARK 465     SER E   115                                                      
REMARK 465     ILE E   116                                                      
REMARK 465     LEU E   117                                                      
REMARK 465     GLN E   118                                                      
REMARK 465     LYS E   119                                                      
REMARK 465     VAL E   120                                                      
REMARK 465     LEU E   121                                                      
REMARK 465     LYS E   122                                                      
REMARK 465     LEU E   123                                                      
REMARK 465     LYS E   124                                                      
REMARK 465     VAL E   125                                                      
REMARK 465     ASP E   126                                                      
REMARK 465     TYR E   127                                                      
REMARK 465     LEU E   128                                                      
REMARK 465     ILE E   129                                                      
REMARK 465     ALA E   130                                                      
REMARK 465     ARG E   131                                                      
REMARK 465     CYS E   132                                                      
REMARK 465     ILE E   133                                                      
REMARK 465     ASP E   134                                                      
REMARK 465     ILE E   135                                                      
REMARK 465     GLN E   136                                                      
REMARK 465     GLN E   137                                                      
REMARK 465     SER E   138                                                      
REMARK 465     ASN E   139                                                      
REMARK 465     GLU E   140                                                      
REMARK 465     VAL E   141                                                      
REMARK 465     GLU E   142                                                      
REMARK 465     ARG E   143                                                      
REMARK 465     THR E   144                                                      
REMARK 465     GLN E   145                                                      
REMARK 465     ALA E   146                                                      
REMARK 465     LEU E   147                                                      
REMARK 465     ARG E   148                                                      
REMARK 465     LEU E   149                                                      
REMARK 465     VAL E   150                                                      
REMARK 465     ARG E   151                                                      
REMARK 465     LYS E   152                                                      
REMARK 465     MET E   153                                                      
REMARK 465     ILE E   154                                                      
REMARK 465     THR E   155                                                      
REMARK 465     VAL E   156                                                      
REMARK 465     ASN E   157                                                      
REMARK 465     ALA E   158                                                      
REMARK 465     SER E   159                                                      
REMARK 465     LEU E   160                                                      
REMARK 465     PHE E   161                                                      
REMARK 465     PRO E   162                                                      
REMARK 465     SER E   163                                                      
REMARK 465     SER E   164                                                      
REMARK 465     VAL E   165                                                      
REMARK 465     THR E   166                                                      
REMARK 465     ASN E   167                                                      
REMARK 465     SER E   168                                                      
REMARK 465     LEU E   169                                                      
REMARK 465     ILE E   170                                                      
REMARK 465     ALA E   171                                                      
REMARK 465     VAL E   172                                                      
REMARK 465     GLY E   173                                                      
REMARK 465     ASN E   174                                                      
REMARK 465     ASP E   175                                                      
REMARK 465     GLY E   176                                                      
REMARK 465     LEU E   177                                                      
REMARK 465     GLN E   178                                                      
REMARK 465     GLU E   179                                                      
REMARK 465     ARG E   180                                                      
REMARK 465     ASP E   181                                                      
REMARK 465     ARG E   182                                                      
REMARK 465     MET E   183                                                      
REMARK 465     VAL E   184                                                      
REMARK 465     ARG E   185                                                      
REMARK 465     ALA E   186                                                      
REMARK 465     CYS E   187                                                      
REMARK 465     ILE E   188                                                      
REMARK 465     ALA E   189                                                      
REMARK 465     ILE E   190                                                      
REMARK 465     ILE E   191                                                      
REMARK 465     UNK E  1019                                                      
REMARK 465     UNK E  1020                                                      
REMARK 465     UNK E  1021                                                      
REMARK 465     UNK E  1022                                                      
REMARK 465     UNK E  1023                                                      
REMARK 465     UNK E  1024                                                      
REMARK 465     UNK E  1025                                                      
REMARK 465     UNK E  1026                                                      
REMARK 465     UNK E  1027                                                      
REMARK 465     UNK E  1028                                                      
REMARK 465     UNK E  1029                                                      
REMARK 465     UNK E  1030                                                      
REMARK 465     UNK E  1031                                                      
REMARK 465     UNK E  1032                                                      
REMARK 465     UNK E  1033                                                      
REMARK 465     UNK E  1034                                                      
REMARK 465     UNK E  1035                                                      
REMARK 465     UNK E  1036                                                      
REMARK 465     UNK E  1037                                                      
REMARK 465     UNK E  1038                                                      
REMARK 465     UNK E  1039                                                      
REMARK 465     UNK E  1040                                                      
REMARK 465     UNK E  1041                                                      
REMARK 465     UNK E  1042                                                      
REMARK 465     UNK E  1043                                                      
REMARK 465     UNK E  1044                                                      
REMARK 465     UNK E  1045                                                      
REMARK 465     UNK E  1046                                                      
REMARK 465     UNK E  1047                                                      
REMARK 465     UNK E  1048                                                      
REMARK 465     UNK E  1049                                                      
REMARK 465     UNK E  1050                                                      
REMARK 465     UNK E  1051                                                      
REMARK 465     UNK E  1052                                                      
REMARK 465     UNK E  1053                                                      
REMARK 465     UNK E  1054                                                      
REMARK 465     UNK E  1055                                                      
REMARK 465     UNK E  1056                                                      
REMARK 465     UNK E  1057                                                      
REMARK 465     UNK E  1058                                                      
REMARK 465     UNK E  1059                                                      
REMARK 465     UNK E  1060                                                      
REMARK 465     UNK E  1061                                                      
REMARK 465     UNK E  1062                                                      
REMARK 465     UNK E  1063                                                      
REMARK 465     UNK E  1064                                                      
REMARK 465     UNK E  1065                                                      
REMARK 465     UNK E  1066                                                      
REMARK 465     UNK E  1067                                                      
REMARK 465     UNK E  1068                                                      
REMARK 465     UNK E  1069                                                      
REMARK 465     UNK E  1070                                                      
REMARK 465     UNK E  1071                                                      
REMARK 465     UNK E  1072                                                      
REMARK 465     UNK E  1073                                                      
REMARK 465     UNK E  1074                                                      
REMARK 465     UNK E  1075                                                      
REMARK 465     UNK E  1076                                                      
REMARK 465     UNK E  1077                                                      
REMARK 465     UNK E  1078                                                      
REMARK 465     UNK E  1079                                                      
REMARK 465     UNK E  1080                                                      
REMARK 465     UNK E  1081                                                      
REMARK 465     UNK E  1082                                                      
REMARK 465     UNK E  1083                                                      
REMARK 465     UNK E  1084                                                      
REMARK 465     UNK E  1085                                                      
REMARK 465     UNK E  1086                                                      
REMARK 465     UNK E  1087                                                      
REMARK 465     UNK E  1088                                                      
REMARK 465     UNK E  1089                                                      
REMARK 465     UNK E  1090                                                      
REMARK 465     UNK E  1091                                                      
REMARK 465     UNK E  1092                                                      
REMARK 465     UNK E  1093                                                      
REMARK 465     UNK E  1094                                                      
REMARK 465     UNK E  1095                                                      
REMARK 465     UNK E  1096                                                      
REMARK 465     UNK E  1097                                                      
REMARK 465     UNK E  1098                                                      
REMARK 465     UNK E  1099                                                      
REMARK 465     UNK E  1100                                                      
REMARK 465     UNK E  1101                                                      
REMARK 465     UNK E  1102                                                      
REMARK 465     UNK E  1103                                                      
REMARK 465     UNK E  1104                                                      
REMARK 465     UNK E  1105                                                      
REMARK 465     UNK E  1106                                                      
REMARK 465     UNK E  1107                                                      
REMARK 465     UNK E  1108                                                      
REMARK 465     UNK E  1109                                                      
REMARK 465     UNK E  1110                                                      
REMARK 465     UNK E  1111                                                      
REMARK 465     UNK E  1112                                                      
REMARK 465     UNK E  1113                                                      
REMARK 465     UNK E  1114                                                      
REMARK 465     UNK E  1115                                                      
REMARK 465     UNK E  1116                                                      
REMARK 465     UNK E  1117                                                      
REMARK 465     UNK E  1118                                                      
REMARK 465     UNK E  1119                                                      
REMARK 465     UNK E  1120                                                      
REMARK 465     UNK E  1121                                                      
REMARK 465     UNK E  1122                                                      
REMARK 465     UNK E  1123                                                      
REMARK 465     UNK E  1124                                                      
REMARK 465     UNK E  1125                                                      
REMARK 465     UNK E  1126                                                      
REMARK 465     UNK E  1127                                                      
REMARK 465     UNK E  1128                                                      
REMARK 465     UNK E  1129                                                      
REMARK 465     UNK E  1130                                                      
REMARK 465     UNK E  1131                                                      
REMARK 465     UNK E  1132                                                      
REMARK 465     UNK E  1133                                                      
REMARK 465     UNK E  1134                                                      
REMARK 465     UNK E  1135                                                      
REMARK 465     UNK E  1136                                                      
REMARK 465     UNK E  1137                                                      
REMARK 465     UNK E  1138                                                      
REMARK 465     UNK E  1139                                                      
REMARK 465     UNK E  1140                                                      
REMARK 465     UNK E  1141                                                      
REMARK 465     UNK E  1142                                                      
REMARK 465     UNK E  1143                                                      
REMARK 465     UNK E  1144                                                      
REMARK 465     UNK E  1145                                                      
REMARK 465     UNK E  1146                                                      
REMARK 465     UNK E  1147                                                      
REMARK 465     UNK E  1148                                                      
REMARK 465     UNK E  1149                                                      
REMARK 465     UNK E  1150                                                      
REMARK 465     UNK E  1151                                                      
REMARK 465     UNK E  1152                                                      
REMARK 465     UNK E  1153                                                      
REMARK 465     UNK E  1154                                                      
REMARK 465     UNK E  1155                                                      
REMARK 465     UNK E  1156                                                      
REMARK 465     UNK E  1157                                                      
REMARK 465     UNK E  1158                                                      
REMARK 465     UNK E  1159                                                      
REMARK 465     UNK E  1160                                                      
REMARK 465     UNK E  1161                                                      
REMARK 465     UNK E  1162                                                      
REMARK 465     UNK E  1163                                                      
REMARK 465     UNK E  1164                                                      
REMARK 465     UNK E  1165                                                      
REMARK 465     UNK E  1166                                                      
REMARK 465     UNK E  1167                                                      
REMARK 465     UNK E  1168                                                      
REMARK 465     UNK E  1169                                                      
REMARK 465     UNK E  1170                                                      
REMARK 465     UNK E  1171                                                      
REMARK 465     UNK E  1172                                                      
REMARK 465     UNK E  1173                                                      
REMARK 465     UNK E  1174                                                      
REMARK 465     UNK E  1175                                                      
REMARK 465     UNK E  1176                                                      
REMARK 465     UNK E  1177                                                      
REMARK 465     UNK E  1178                                                      
REMARK 465     UNK E  1179                                                      
REMARK 465     UNK E  1180                                                      
REMARK 465     UNK E  1181                                                      
REMARK 465     UNK E  1182                                                      
REMARK 465     UNK E  1183                                                      
REMARK 465     UNK E  1184                                                      
REMARK 465     UNK E  1185                                                      
REMARK 465     UNK E  1186                                                      
REMARK 465     UNK E  1187                                                      
REMARK 465     UNK E  1188                                                      
REMARK 465     UNK E  1189                                                      
REMARK 465     UNK E  1190                                                      
REMARK 465     UNK E  1191                                                      
REMARK 465     UNK E  1192                                                      
REMARK 465     UNK E  1193                                                      
REMARK 465     UNK E  1194                                                      
REMARK 465     UNK E  1195                                                      
REMARK 465     UNK E  1196                                                      
REMARK 465     UNK E  1197                                                      
REMARK 465     UNK E  1198                                                      
REMARK 465     UNK E  1199                                                      
REMARK 465     UNK E  1200                                                      
REMARK 465     UNK E  1201                                                      
REMARK 465     UNK E  1202                                                      
REMARK 465     UNK E  1203                                                      
REMARK 465     UNK E  1204                                                      
REMARK 465     UNK E  1205                                                      
REMARK 465     UNK E  1206                                                      
REMARK 465     UNK E  1207                                                      
REMARK 465     UNK E  1208                                                      
REMARK 465     UNK E  1209                                                      
REMARK 465     UNK E  1210                                                      
REMARK 465     UNK E  1211                                                      
REMARK 465     UNK E  1212                                                      
REMARK 465     UNK E  1213                                                      
REMARK 465     UNK E  1214                                                      
REMARK 465     UNK E  1215                                                      
REMARK 465     UNK E  1216                                                      
REMARK 465     UNK E  1217                                                      
REMARK 465     UNK E  1218                                                      
REMARK 465     UNK E  1219                                                      
REMARK 465     UNK E  1220                                                      
REMARK 465     UNK E  1221                                                      
REMARK 465     UNK E  1222                                                      
REMARK 465     UNK E  1223                                                      
REMARK 465     UNK E  1224                                                      
REMARK 465     UNK E  1225                                                      
REMARK 465     UNK E  1226                                                      
REMARK 465     UNK E  1227                                                      
REMARK 465     UNK E  1228                                                      
REMARK 465     UNK E  1229                                                      
REMARK 465     UNK E  1230                                                      
REMARK 465     UNK E  1231                                                      
REMARK 465     UNK E  1232                                                      
REMARK 465     UNK E  1233                                                      
REMARK 465     UNK E  1234                                                      
REMARK 465     UNK E  1235                                                      
REMARK 465     UNK E  1236                                                      
REMARK 465     UNK E  1237                                                      
REMARK 465     UNK E  1238                                                      
REMARK 465     UNK E  1239                                                      
REMARK 465     UNK E  1240                                                      
REMARK 465     UNK E  1241                                                      
REMARK 465     UNK E  1242                                                      
REMARK 465     UNK E  1243                                                      
REMARK 465     UNK E  1244                                                      
REMARK 465     UNK E  1245                                                      
REMARK 465     UNK E  1246                                                      
REMARK 465     UNK E  1247                                                      
REMARK 465     UNK E  1248                                                      
REMARK 465     UNK E  1249                                                      
REMARK 465     UNK E  1250                                                      
REMARK 465     UNK E  1251                                                      
REMARK 465     UNK E  1252                                                      
REMARK 465     UNK E  1253                                                      
REMARK 465     UNK E  1254                                                      
REMARK 465     UNK E  1255                                                      
REMARK 465     UNK E  1256                                                      
REMARK 465     UNK E  1257                                                      
REMARK 465     UNK E  1258                                                      
REMARK 465     UNK E  1259                                                      
REMARK 465     UNK E  1260                                                      
REMARK 465     UNK E  1261                                                      
REMARK 465     UNK E  1262                                                      
REMARK 465     UNK E  1263                                                      
REMARK 465     UNK E  1264                                                      
REMARK 465     UNK E  1265                                                      
REMARK 465     UNK E  1266                                                      
REMARK 465     UNK E  1267                                                      
REMARK 465     UNK E  1268                                                      
REMARK 465     UNK E  1269                                                      
REMARK 465     UNK E  1270                                                      
REMARK 465     UNK E  1271                                                      
REMARK 465     UNK E  1272                                                      
REMARK 465     UNK E  1273                                                      
REMARK 465     UNK E  1274                                                      
REMARK 465     UNK E  1275                                                      
REMARK 465     UNK E  1276                                                      
REMARK 465     UNK E  1277                                                      
REMARK 465     UNK E  1278                                                      
REMARK 465     UNK E  1279                                                      
REMARK 465     UNK E  1280                                                      
REMARK 465     UNK E  1281                                                      
REMARK 465     UNK E  1282                                                      
REMARK 465     UNK E  1283                                                      
REMARK 465     UNK E  1284                                                      
REMARK 465     UNK E  1285                                                      
REMARK 465     UNK E  1286                                                      
REMARK 465     UNK E  1287                                                      
REMARK 465     UNK E  1288                                                      
REMARK 465     UNK E  1289                                                      
REMARK 465     UNK E  1290                                                      
REMARK 465     UNK E  1291                                                      
REMARK 465     UNK E  1292                                                      
REMARK 465     UNK E  1293                                                      
REMARK 465     UNK E  1294                                                      
REMARK 465     UNK E  1295                                                      
REMARK 465     UNK E  1296                                                      
REMARK 465     UNK E  1297                                                      
REMARK 465     UNK E  1298                                                      
REMARK 465     UNK E  1299                                                      
REMARK 465     UNK E  1300                                                      
REMARK 465     UNK E  1301                                                      
REMARK 465     UNK E  1302                                                      
REMARK 465     UNK E  1303                                                      
REMARK 465     UNK E  1304                                                      
REMARK 465     UNK E  1305                                                      
REMARK 465     UNK E  1306                                                      
REMARK 465     UNK E  1307                                                      
REMARK 465     UNK E  1308                                                      
REMARK 465     UNK E  1309                                                      
REMARK 465     UNK E  1310                                                      
REMARK 465     UNK E  1311                                                      
REMARK 465     UNK E  1312                                                      
REMARK 465     UNK E  1313                                                      
REMARK 465     UNK E  1314                                                      
REMARK 465     UNK E  1315                                                      
REMARK 465     UNK E  1316                                                      
REMARK 465     UNK E  1317                                                      
REMARK 465     UNK E  1318                                                      
REMARK 465     UNK E  1319                                                      
REMARK 465     UNK E  1320                                                      
REMARK 465     UNK E  1321                                                      
REMARK 465     UNK E  1322                                                      
REMARK 465     UNK E  1323                                                      
REMARK 465     UNK E  1324                                                      
REMARK 465     UNK E  1325                                                      
REMARK 465     UNK E  1326                                                      
REMARK 465     UNK E  1327                                                      
REMARK 465     UNK E  1328                                                      
REMARK 465     UNK E  1329                                                      
REMARK 465     UNK E  1330                                                      
REMARK 465     UNK E  1331                                                      
REMARK 465     UNK E  1332                                                      
REMARK 465     UNK E  1333                                                      
REMARK 465     UNK E  1334                                                      
REMARK 465     UNK E  1335                                                      
REMARK 465     UNK E  1336                                                      
REMARK 465     UNK E  1337                                                      
REMARK 465     UNK E  1338                                                      
REMARK 465     UNK E  1339                                                      
REMARK 465     UNK E  1340                                                      
REMARK 465     UNK E  1341                                                      
REMARK 465     UNK E  1342                                                      
REMARK 465     UNK E  1343                                                      
REMARK 465     UNK E  1344                                                      
REMARK 465     UNK E  1345                                                      
REMARK 465     UNK E  1346                                                      
REMARK 465     UNK E  1347                                                      
REMARK 465     UNK E  1348                                                      
REMARK 465     UNK E  1349                                                      
REMARK 465     UNK E  1350                                                      
REMARK 465     UNK E  1351                                                      
REMARK 465     UNK E  1352                                                      
REMARK 465     UNK E  1353                                                      
REMARK 465     UNK E  1354                                                      
REMARK 465     UNK E  1355                                                      
REMARK 465     UNK E  1356                                                      
REMARK 465     UNK E  1357                                                      
REMARK 465     UNK E  1358                                                      
REMARK 465     UNK E  1359                                                      
REMARK 465     UNK E  1360                                                      
REMARK 465     UNK E  1361                                                      
REMARK 465     UNK E  1362                                                      
REMARK 465     UNK E  1363                                                      
REMARK 465     UNK E  1364                                                      
REMARK 465     UNK E  1365                                                      
REMARK 465     UNK E  1366                                                      
REMARK 465     UNK E  1367                                                      
REMARK 465     UNK E  1368                                                      
REMARK 465     UNK E  1369                                                      
REMARK 465     UNK E  1370                                                      
REMARK 465     UNK E  1371                                                      
REMARK 465     UNK E  1372                                                      
REMARK 465     UNK E  1373                                                      
REMARK 465     UNK E  1374                                                      
REMARK 465     UNK E  1375                                                      
REMARK 465     UNK E  1376                                                      
REMARK 465     UNK E  1377                                                      
REMARK 465     UNK E  1378                                                      
REMARK 465     UNK E  1379                                                      
REMARK 465     UNK E  1380                                                      
REMARK 465     UNK E  1381                                                      
REMARK 465     UNK E  1382                                                      
REMARK 465     UNK E  1383                                                      
REMARK 465     UNK E  1384                                                      
REMARK 465     UNK E  1385                                                      
REMARK 465     UNK E  1386                                                      
REMARK 465     UNK E  1387                                                      
REMARK 465     UNK E  1388                                                      
REMARK 465     UNK E  1389                                                      
REMARK 465     UNK E  1390                                                      
REMARK 465     UNK E  1391                                                      
REMARK 465     UNK E  1392                                                      
REMARK 465     UNK E  1393                                                      
REMARK 465     UNK E  1394                                                      
REMARK 465     UNK E  1395                                                      
REMARK 465     UNK E  1396                                                      
REMARK 465     UNK E  1397                                                      
REMARK 465     UNK E  1398                                                      
REMARK 465     UNK E  1399                                                      
REMARK 465     UNK E  1400                                                      
REMARK 465     UNK E  1401                                                      
REMARK 465     UNK E  1402                                                      
REMARK 465     UNK E  1403                                                      
REMARK 465     UNK E  1404                                                      
REMARK 465     UNK E  1405                                                      
REMARK 465     UNK E  1406                                                      
REMARK 465     UNK E  1407                                                      
REMARK 465     UNK E  1408                                                      
REMARK 465     UNK E  1409                                                      
REMARK 465     UNK E  1410                                                      
REMARK 465     UNK E  1411                                                      
REMARK 465     UNK E  1412                                                      
REMARK 465     UNK E  1413                                                      
REMARK 465     UNK E  1414                                                      
REMARK 465     UNK E  1415                                                      
REMARK 465     UNK E  1416                                                      
REMARK 465     UNK E  1417                                                      
REMARK 465     UNK E  1418                                                      
REMARK 465     UNK E  1419                                                      
REMARK 465     UNK E  1420                                                      
REMARK 465     UNK E  1421                                                      
REMARK 465     UNK E  1422                                                      
REMARK 465     UNK E  1423                                                      
REMARK 465     UNK E  1424                                                      
REMARK 465     UNK E  1425                                                      
REMARK 465     UNK E  1426                                                      
REMARK 465     UNK E  1427                                                      
REMARK 465     UNK E  1428                                                      
REMARK 465     UNK E  1429                                                      
REMARK 465     UNK E  1430                                                      
REMARK 465     UNK E  1431                                                      
REMARK 465     UNK E  1432                                                      
REMARK 465     UNK E  1433                                                      
REMARK 465     UNK E  1434                                                      
REMARK 465     UNK E  1435                                                      
REMARK 465     UNK E  1436                                                      
REMARK 465     UNK E  1437                                                      
REMARK 465     UNK E  1438                                                      
REMARK 465     UNK E  1439                                                      
REMARK 465     UNK E  1440                                                      
REMARK 465     UNK E  1441                                                      
REMARK 465     UNK E  1442                                                      
REMARK 465     UNK E  1443                                                      
REMARK 465     UNK E  1444                                                      
REMARK 465     UNK E  1445                                                      
REMARK 465     UNK E  1446                                                      
REMARK 465     UNK E  1447                                                      
REMARK 465     UNK E  1448                                                      
REMARK 465     UNK E  1449                                                      
REMARK 465     UNK E  1450                                                      
REMARK 465     UNK E  1451                                                      
REMARK 465     UNK E  1452                                                      
REMARK 465     UNK E  1453                                                      
REMARK 465     UNK E  1454                                                      
REMARK 465     UNK E  1455                                                      
REMARK 465     UNK E  1456                                                      
REMARK 465     UNK E  1457                                                      
REMARK 465     UNK E  1458                                                      
REMARK 465     UNK E  1459                                                      
REMARK 465     UNK E  1460                                                      
REMARK 465     UNK E  1461                                                      
REMARK 465     UNK E  1462                                                      
REMARK 465     UNK E  1463                                                      
REMARK 465     UNK E  1464                                                      
REMARK 465     UNK E  1465                                                      
REMARK 465     UNK E  1466                                                      
REMARK 465     UNK E  1467                                                      
REMARK 465     UNK E  1468                                                      
REMARK 465     UNK E  1469                                                      
REMARK 465     UNK E  1470                                                      
REMARK 465     UNK E  1471                                                      
REMARK 465     UNK E  1472                                                      
REMARK 465     UNK E  1473                                                      
REMARK 465     UNK E  1474                                                      
REMARK 465     UNK E  1475                                                      
REMARK 465     UNK E  1476                                                      
REMARK 465     UNK E  1477                                                      
REMARK 465     UNK E  1478                                                      
REMARK 465     UNK E  1479                                                      
REMARK 465     UNK E  1480                                                      
REMARK 465     UNK E  1481                                                      
REMARK 465     UNK E  1482                                                      
REMARK 465     UNK E  1483                                                      
REMARK 465     UNK E  1484                                                      
REMARK 465     UNK E  1485                                                      
REMARK 465     UNK E  1486                                                      
REMARK 465     UNK E  1487                                                      
REMARK 465     UNK E  1488                                                      
REMARK 465     UNK E  1489                                                      
REMARK 465     UNK E  1490                                                      
REMARK 465     UNK E  1491                                                      
REMARK 465     UNK E  1492                                                      
REMARK 465     UNK E  1493                                                      
REMARK 465     UNK E  1494                                                      
REMARK 465     UNK E  1495                                                      
REMARK 465     UNK E  1496                                                      
REMARK 465     UNK E  1497                                                      
REMARK 465     UNK E  1498                                                      
REMARK 465     UNK E  1499                                                      
REMARK 465     UNK E  1500                                                      
REMARK 465     UNK E  1501                                                      
REMARK 465     UNK E  1502                                                      
REMARK 465     UNK E  1503                                                      
REMARK 465     UNK E  1504                                                      
REMARK 465     UNK E  1505                                                      
REMARK 465     UNK E  1506                                                      
REMARK 465     UNK E  1507                                                      
REMARK 465     UNK E  1508                                                      
REMARK 465     UNK E  1509                                                      
REMARK 465     UNK E  1510                                                      
REMARK 465     UNK E  1511                                                      
REMARK 465     UNK E  1512                                                      
REMARK 465     UNK E  1513                                                      
REMARK 465     UNK E  1514                                                      
REMARK 465     UNK E  1515                                                      
REMARK 465     UNK E  1516                                                      
REMARK 465     UNK E  1517                                                      
REMARK 465     UNK E  1518                                                      
REMARK 465     UNK E  1519                                                      
REMARK 465     UNK E  1520                                                      
REMARK 465     UNK E  1521                                                      
REMARK 465     UNK E  1522                                                      
REMARK 465     UNK E  1523                                                      
REMARK 465     UNK E  1524                                                      
REMARK 465     UNK E  1525                                                      
REMARK 465     UNK E  1526                                                      
REMARK 465     UNK E  1527                                                      
REMARK 465     UNK E  1528                                                      
REMARK 465     UNK E  1529                                                      
REMARK 465     UNK E  1530                                                      
REMARK 465     UNK E  1531                                                      
REMARK 465     UNK E  1532                                                      
REMARK 465     UNK E  1533                                                      
REMARK 465     UNK E  1534                                                      
REMARK 465     UNK E  1535                                                      
REMARK 465     UNK E  1536                                                      
REMARK 465     UNK E  1537                                                      
REMARK 465     UNK E  1538                                                      
REMARK 465     UNK E  1539                                                      
REMARK 465     UNK E  1540                                                      
REMARK 465     UNK E  1541                                                      
REMARK 465     UNK E  1542                                                      
REMARK 465     UNK E  1543                                                      
REMARK 465     UNK E  1544                                                      
REMARK 465     UNK E  1545                                                      
REMARK 465     UNK E  1546                                                      
REMARK 465     UNK E  1547                                                      
REMARK 465     UNK E  1548                                                      
REMARK 465     UNK E  1549                                                      
REMARK 465     UNK E  1550                                                      
REMARK 465     UNK E  1551                                                      
REMARK 465     UNK E  1552                                                      
REMARK 465     UNK E  1553                                                      
REMARK 465     UNK E  1554                                                      
REMARK 465     UNK E  1555                                                      
REMARK 465     UNK E  1556                                                      
REMARK 465     UNK E  1557                                                      
REMARK 465     UNK E  1558                                                      
REMARK 465     UNK E  1559                                                      
REMARK 465     UNK E  1560                                                      
REMARK 465     UNK E  1561                                                      
REMARK 465     UNK E  1562                                                      
REMARK 465     UNK E  1563                                                      
REMARK 465     UNK E  1564                                                      
REMARK 465     UNK E  1565                                                      
REMARK 465     UNK E  1566                                                      
REMARK 465     UNK E  1567                                                      
REMARK 465     UNK E  1568                                                      
REMARK 465     UNK E  1569                                                      
REMARK 465     UNK E  1570                                                      
REMARK 465     UNK E  1571                                                      
REMARK 465     UNK E  1572                                                      
REMARK 465     UNK E  1573                                                      
REMARK 465     UNK E  1574                                                      
REMARK 465     UNK E  1575                                                      
REMARK 465     UNK E  1576                                                      
REMARK 465     UNK E  1577                                                      
REMARK 465     UNK E  1578                                                      
REMARK 465     UNK E  1579                                                      
REMARK 465     UNK E  1580                                                      
REMARK 465     UNK E  1581                                                      
REMARK 465     UNK E  1582                                                      
REMARK 465     UNK E  1583                                                      
REMARK 465     UNK E  1584                                                      
REMARK 465     UNK E  1585                                                      
REMARK 465     UNK E  1586                                                      
REMARK 465     UNK E  1587                                                      
REMARK 465     UNK E  1588                                                      
REMARK 465     UNK E  1589                                                      
REMARK 465     UNK E  1590                                                      
REMARK 465     UNK E  1591                                                      
REMARK 465     UNK E  1592                                                      
REMARK 465     UNK E  1593                                                      
REMARK 465     UNK E  1594                                                      
REMARK 465     UNK E  1595                                                      
REMARK 465     UNK E  1596                                                      
REMARK 465     UNK E  1597                                                      
REMARK 465     UNK E  1598                                                      
REMARK 465     UNK E  1599                                                      
REMARK 465     UNK E  1600                                                      
REMARK 465     UNK E  1601                                                      
REMARK 465     UNK E  1602                                                      
REMARK 465     UNK E  1603                                                      
REMARK 465     UNK E  1604                                                      
REMARK 465     UNK E  1605                                                      
REMARK 465     UNK E  1606                                                      
REMARK 465     UNK E  1607                                                      
REMARK 465     UNK E  1608                                                      
REMARK 465     UNK E  1609                                                      
REMARK 465     UNK E  1627                                                      
REMARK 465     UNK E  1628                                                      
REMARK 465     UNK E  1629                                                      
REMARK 465     UNK E  1650                                                      
REMARK 465     UNK E  1651                                                      
REMARK 465     UNK E  1652                                                      
REMARK 465     UNK E  1653                                                      
REMARK 465     UNK E  1654                                                      
REMARK 465     UNK E  1655                                                      
REMARK 465     UNK E  1656                                                      
REMARK 465     UNK E  1657                                                      
REMARK 465     UNK E  1658                                                      
REMARK 465     UNK E  1659                                                      
REMARK 465     UNK E  1660                                                      
REMARK 465     UNK E  1661                                                      
REMARK 465     UNK E  1662                                                      
REMARK 465     UNK E  1663                                                      
REMARK 465     UNK E  1664                                                      
REMARK 465     UNK E  1665                                                      
REMARK 465     UNK E  1666                                                      
REMARK 465     UNK E  1667                                                      
REMARK 465     UNK E  1668                                                      
REMARK 465     UNK E  1669                                                      
REMARK 465     UNK E  1670                                                      
REMARK 465     UNK E  1671                                                      
REMARK 465     UNK E  1672                                                      
REMARK 465     UNK E  1673                                                      
REMARK 465     UNK E  1674                                                      
REMARK 465     UNK E  1675                                                      
REMARK 465     UNK E  1676                                                      
REMARK 465     UNK E  1677                                                      
REMARK 465     UNK E  1678                                                      
REMARK 465     UNK E  1679                                                      
REMARK 465     UNK E  1696                                                      
REMARK 465     UNK E  1697                                                      
REMARK 465     UNK E  1698                                                      
REMARK 465     UNK E  1699                                                      
REMARK 465     UNK E  1700                                                      
REMARK 465     UNK E  1701                                                      
REMARK 465     UNK E  1702                                                      
REMARK 465     UNK E  1703                                                      
REMARK 465     UNK E  1704                                                      
REMARK 465     UNK E  1705                                                      
REMARK 465     UNK E  1706                                                      
REMARK 465     UNK E  1707                                                      
REMARK 465     UNK E  1708                                                      
REMARK 465     MET F     1                                                      
REMARK 465     ALA F     2                                                      
REMARK 465     ALA F     3                                                      
REMARK 465     ILE F     4                                                      
REMARK 465     GLY F     5                                                      
REMARK 465     ARG F     6                                                      
REMARK 465     GLY F     7                                                      
REMARK 465     ARG F     8                                                      
REMARK 465     SER F     9                                                      
REMARK 465     LEU F    10                                                      
REMARK 465     LYS F    11                                                      
REMARK 465     ASN F    12                                                      
REMARK 465     LEU F    13                                                      
REMARK 465     ARG F    14                                                      
REMARK 465     VAL F    15                                                      
REMARK 465     ARG F    16                                                      
REMARK 465     GLY F    17                                                      
REMARK 465     ARG F    18                                                      
REMARK 465     ASN F    19                                                      
REMARK 465     ASP F    20                                                      
REMARK 465     SER F    21                                                      
REMARK 465     GLY F    22                                                      
REMARK 465     GLU F    23                                                      
REMARK 465     GLU F    24                                                      
REMARK 465     ASN F    25                                                      
REMARK 465     VAL F    26                                                      
REMARK 465     PRO F    27                                                      
REMARK 465     LEU F    28                                                      
REMARK 465     ASP F    29                                                      
REMARK 465     LEU F    30                                                      
REMARK 465     THR F    31                                                      
REMARK 465     ARG F    32                                                      
REMARK 465     GLU F    33                                                      
REMARK 465     PRO F    34                                                      
REMARK 465     SER F    35                                                      
REMARK 465     ASP F    36                                                      
REMARK 465     ASN F    37                                                      
REMARK 465     LEU F    38                                                      
REMARK 465     ARG F    39                                                      
REMARK 465     GLU F    40                                                      
REMARK 465     ILE F    41                                                      
REMARK 465     LEU F    42                                                      
REMARK 465     GLN F    43                                                      
REMARK 465     ASN F    44                                                      
REMARK 465     VAL F    45                                                      
REMARK 465     ALA F    46                                                      
REMARK 465     ARG F    47                                                      
REMARK 465     LEU F    48                                                      
REMARK 465     GLN F    49                                                      
REMARK 465     GLY F    50                                                      
REMARK 465     VAL F    51                                                      
REMARK 465     SER F    52                                                      
REMARK 465     ASN F    53                                                      
REMARK 465     MET F    54                                                      
REMARK 465     ARG F    55                                                      
REMARK 465     LYS F    56                                                      
REMARK 465     LEU F    57                                                      
REMARK 465     GLY F    58                                                      
REMARK 465     HIS F    59                                                      
REMARK 465     LEU F    60                                                      
REMARK 465     ASN F    61                                                      
REMARK 465     ASN F    62                                                      
REMARK 465     PHE F    63                                                      
REMARK 465     THR F    64                                                      
REMARK 465     LYS F    65                                                      
REMARK 465     LEU F    66                                                      
REMARK 465     LEU F    67                                                      
REMARK 465     CYS F    68                                                      
REMARK 465     ASP F    69                                                      
REMARK 465     ILE F    70                                                      
REMARK 465     GLY F    71                                                      
REMARK 465     HIS F    72                                                      
REMARK 465     SER F    73                                                      
REMARK 465     GLU F    74                                                      
REMARK 465     GLU F    75                                                      
REMARK 465     LYS F    76                                                      
REMARK 465     LEU F    77                                                      
REMARK 465     GLY F    78                                                      
REMARK 465     PHE F    79                                                      
REMARK 465     HIS F    80                                                      
REMARK 465     TYR F    81                                                      
REMARK 465     GLU F    82                                                      
REMARK 465     ASP F    83                                                      
REMARK 465     ILE F    84                                                      
REMARK 465     ILE F    85                                                      
REMARK 465     ILE F    86                                                      
REMARK 465     CYS F    87                                                      
REMARK 465     LEU F    88                                                      
REMARK 465     ARG F    89                                                      
REMARK 465     LEU F    90                                                      
REMARK 465     ALA F    91                                                      
REMARK 465     LEU F    92                                                      
REMARK 465     LEU F    93                                                      
REMARK 465     ASN F    94                                                      
REMARK 465     GLU F    95                                                      
REMARK 465     ALA F    96                                                      
REMARK 465     LYS F    97                                                      
REMARK 465     GLU F    98                                                      
REMARK 465     VAL F    99                                                      
REMARK 465     ARG F   100                                                      
REMARK 465     ALA F   101                                                      
REMARK 465     ALA F   102                                                      
REMARK 465     GLY F   103                                                      
REMARK 465     LEU F   104                                                      
REMARK 465     ARG F   105                                                      
REMARK 465     ALA F   106                                                      
REMARK 465     LEU F   107                                                      
REMARK 465     ARG F   108                                                      
REMARK 465     TYR F   109                                                      
REMARK 465     LEU F   110                                                      
REMARK 465     ILE F   111                                                      
REMARK 465     GLN F   112                                                      
REMARK 465     ASP F   113                                                      
REMARK 465     SER F   114                                                      
REMARK 465     SER F   115                                                      
REMARK 465     ILE F   116                                                      
REMARK 465     LEU F   117                                                      
REMARK 465     GLN F   118                                                      
REMARK 465     LYS F   119                                                      
REMARK 465     VAL F   120                                                      
REMARK 465     LEU F   121                                                      
REMARK 465     LYS F   122                                                      
REMARK 465     LEU F   123                                                      
REMARK 465     LYS F   124                                                      
REMARK 465     VAL F   125                                                      
REMARK 465     ASP F   126                                                      
REMARK 465     TYR F   127                                                      
REMARK 465     LEU F   128                                                      
REMARK 465     ILE F   129                                                      
REMARK 465     ALA F   130                                                      
REMARK 465     ARG F   131                                                      
REMARK 465     CYS F   132                                                      
REMARK 465     ILE F   133                                                      
REMARK 465     ASP F   134                                                      
REMARK 465     ILE F   135                                                      
REMARK 465     GLN F   136                                                      
REMARK 465     GLN F   137                                                      
REMARK 465     SER F   138                                                      
REMARK 465     ASN F   139                                                      
REMARK 465     GLU F   140                                                      
REMARK 465     VAL F   141                                                      
REMARK 465     GLU F   142                                                      
REMARK 465     ARG F   143                                                      
REMARK 465     THR F   144                                                      
REMARK 465     GLN F   145                                                      
REMARK 465     ALA F   146                                                      
REMARK 465     LEU F   147                                                      
REMARK 465     ARG F   148                                                      
REMARK 465     LEU F   149                                                      
REMARK 465     VAL F   150                                                      
REMARK 465     ARG F   151                                                      
REMARK 465     LYS F   152                                                      
REMARK 465     MET F   153                                                      
REMARK 465     ILE F   154                                                      
REMARK 465     THR F   155                                                      
REMARK 465     VAL F   156                                                      
REMARK 465     ASN F   157                                                      
REMARK 465     ALA F   158                                                      
REMARK 465     SER F   159                                                      
REMARK 465     LEU F   160                                                      
REMARK 465     PHE F   161                                                      
REMARK 465     PRO F   162                                                      
REMARK 465     SER F   163                                                      
REMARK 465     SER F   164                                                      
REMARK 465     VAL F   165                                                      
REMARK 465     THR F   166                                                      
REMARK 465     ASN F   167                                                      
REMARK 465     SER F   168                                                      
REMARK 465     LEU F   169                                                      
REMARK 465     ILE F   170                                                      
REMARK 465     ALA F   171                                                      
REMARK 465     VAL F   172                                                      
REMARK 465     GLY F   173                                                      
REMARK 465     ASN F   174                                                      
REMARK 465     ASP F   175                                                      
REMARK 465     GLY F   176                                                      
REMARK 465     LEU F   177                                                      
REMARK 465     GLN F   178                                                      
REMARK 465     GLU F   179                                                      
REMARK 465     ARG F   180                                                      
REMARK 465     ASP F   181                                                      
REMARK 465     ARG F   182                                                      
REMARK 465     MET F   183                                                      
REMARK 465     VAL F   184                                                      
REMARK 465     ARG F   185                                                      
REMARK 465     ALA F   186                                                      
REMARK 465     CYS F   187                                                      
REMARK 465     ILE F   188                                                      
REMARK 465     ALA F   189                                                      
REMARK 465     ILE F   190                                                      
REMARK 465     ILE F   191                                                      
REMARK 465     UNK F  1019                                                      
REMARK 465     UNK F  1020                                                      
REMARK 465     UNK F  1021                                                      
REMARK 465     UNK F  1022                                                      
REMARK 465     UNK F  1023                                                      
REMARK 465     UNK F  1024                                                      
REMARK 465     UNK F  1025                                                      
REMARK 465     UNK F  1026                                                      
REMARK 465     UNK F  1027                                                      
REMARK 465     UNK F  1028                                                      
REMARK 465     UNK F  1029                                                      
REMARK 465     UNK F  1030                                                      
REMARK 465     UNK F  1031                                                      
REMARK 465     UNK F  1032                                                      
REMARK 465     UNK F  1033                                                      
REMARK 465     UNK F  1034                                                      
REMARK 465     UNK F  1035                                                      
REMARK 465     UNK F  1036                                                      
REMARK 465     UNK F  1037                                                      
REMARK 465     UNK F  1038                                                      
REMARK 465     UNK F  1039                                                      
REMARK 465     UNK F  1040                                                      
REMARK 465     UNK F  1041                                                      
REMARK 465     UNK F  1042                                                      
REMARK 465     UNK F  1043                                                      
REMARK 465     UNK F  1044                                                      
REMARK 465     UNK F  1045                                                      
REMARK 465     UNK F  1046                                                      
REMARK 465     UNK F  1047                                                      
REMARK 465     UNK F  1048                                                      
REMARK 465     UNK F  1049                                                      
REMARK 465     UNK F  1050                                                      
REMARK 465     UNK F  1051                                                      
REMARK 465     UNK F  1052                                                      
REMARK 465     UNK F  1053                                                      
REMARK 465     UNK F  1054                                                      
REMARK 465     UNK F  1055                                                      
REMARK 465     UNK F  1056                                                      
REMARK 465     UNK F  1057                                                      
REMARK 465     UNK F  1058                                                      
REMARK 465     UNK F  1059                                                      
REMARK 465     UNK F  1060                                                      
REMARK 465     UNK F  1061                                                      
REMARK 465     UNK F  1062                                                      
REMARK 465     UNK F  1063                                                      
REMARK 465     UNK F  1064                                                      
REMARK 465     UNK F  1065                                                      
REMARK 465     UNK F  1066                                                      
REMARK 465     UNK F  1067                                                      
REMARK 465     UNK F  1068                                                      
REMARK 465     UNK F  1069                                                      
REMARK 465     UNK F  1070                                                      
REMARK 465     UNK F  1071                                                      
REMARK 465     UNK F  1072                                                      
REMARK 465     UNK F  1073                                                      
REMARK 465     UNK F  1074                                                      
REMARK 465     UNK F  1075                                                      
REMARK 465     UNK F  1076                                                      
REMARK 465     UNK F  1077                                                      
REMARK 465     UNK F  1078                                                      
REMARK 465     UNK F  1079                                                      
REMARK 465     UNK F  1080                                                      
REMARK 465     UNK F  1081                                                      
REMARK 465     UNK F  1082                                                      
REMARK 465     UNK F  1083                                                      
REMARK 465     UNK F  1084                                                      
REMARK 465     UNK F  1085                                                      
REMARK 465     UNK F  1086                                                      
REMARK 465     UNK F  1087                                                      
REMARK 465     UNK F  1088                                                      
REMARK 465     UNK F  1089                                                      
REMARK 465     UNK F  1090                                                      
REMARK 465     UNK F  1091                                                      
REMARK 465     UNK F  1092                                                      
REMARK 465     UNK F  1093                                                      
REMARK 465     UNK F  1094                                                      
REMARK 465     UNK F  1095                                                      
REMARK 465     UNK F  1096                                                      
REMARK 465     UNK F  1097                                                      
REMARK 465     UNK F  1098                                                      
REMARK 465     UNK F  1099                                                      
REMARK 465     UNK F  1100                                                      
REMARK 465     UNK F  1101                                                      
REMARK 465     UNK F  1102                                                      
REMARK 465     UNK F  1103                                                      
REMARK 465     UNK F  1104                                                      
REMARK 465     UNK F  1105                                                      
REMARK 465     UNK F  1106                                                      
REMARK 465     UNK F  1107                                                      
REMARK 465     UNK F  1108                                                      
REMARK 465     UNK F  1109                                                      
REMARK 465     UNK F  1110                                                      
REMARK 465     UNK F  1111                                                      
REMARK 465     UNK F  1112                                                      
REMARK 465     UNK F  1113                                                      
REMARK 465     UNK F  1114                                                      
REMARK 465     UNK F  1115                                                      
REMARK 465     UNK F  1116                                                      
REMARK 465     UNK F  1117                                                      
REMARK 465     UNK F  1118                                                      
REMARK 465     UNK F  1119                                                      
REMARK 465     UNK F  1120                                                      
REMARK 465     UNK F  1121                                                      
REMARK 465     UNK F  1122                                                      
REMARK 465     UNK F  1123                                                      
REMARK 465     UNK F  1124                                                      
REMARK 465     UNK F  1125                                                      
REMARK 465     UNK F  1126                                                      
REMARK 465     UNK F  1127                                                      
REMARK 465     UNK F  1128                                                      
REMARK 465     UNK F  1129                                                      
REMARK 465     UNK F  1130                                                      
REMARK 465     UNK F  1131                                                      
REMARK 465     UNK F  1132                                                      
REMARK 465     UNK F  1133                                                      
REMARK 465     UNK F  1134                                                      
REMARK 465     UNK F  1135                                                      
REMARK 465     UNK F  1136                                                      
REMARK 465     UNK F  1137                                                      
REMARK 465     UNK F  1138                                                      
REMARK 465     UNK F  1139                                                      
REMARK 465     UNK F  1140                                                      
REMARK 465     UNK F  1141                                                      
REMARK 465     UNK F  1142                                                      
REMARK 465     UNK F  1143                                                      
REMARK 465     UNK F  1144                                                      
REMARK 465     UNK F  1145                                                      
REMARK 465     UNK F  1146                                                      
REMARK 465     UNK F  1147                                                      
REMARK 465     UNK F  1148                                                      
REMARK 465     UNK F  1149                                                      
REMARK 465     UNK F  1150                                                      
REMARK 465     UNK F  1151                                                      
REMARK 465     UNK F  1152                                                      
REMARK 465     UNK F  1153                                                      
REMARK 465     UNK F  1154                                                      
REMARK 465     UNK F  1155                                                      
REMARK 465     UNK F  1156                                                      
REMARK 465     UNK F  1157                                                      
REMARK 465     UNK F  1158                                                      
REMARK 465     UNK F  1159                                                      
REMARK 465     UNK F  1160                                                      
REMARK 465     UNK F  1161                                                      
REMARK 465     UNK F  1162                                                      
REMARK 465     UNK F  1163                                                      
REMARK 465     UNK F  1164                                                      
REMARK 465     UNK F  1165                                                      
REMARK 465     UNK F  1166                                                      
REMARK 465     UNK F  1167                                                      
REMARK 465     UNK F  1168                                                      
REMARK 465     UNK F  1169                                                      
REMARK 465     UNK F  1170                                                      
REMARK 465     UNK F  1171                                                      
REMARK 465     UNK F  1172                                                      
REMARK 465     UNK F  1173                                                      
REMARK 465     UNK F  1174                                                      
REMARK 465     UNK F  1175                                                      
REMARK 465     UNK F  1176                                                      
REMARK 465     UNK F  1177                                                      
REMARK 465     UNK F  1178                                                      
REMARK 465     UNK F  1179                                                      
REMARK 465     UNK F  1180                                                      
REMARK 465     UNK F  1181                                                      
REMARK 465     UNK F  1182                                                      
REMARK 465     UNK F  1183                                                      
REMARK 465     UNK F  1184                                                      
REMARK 465     UNK F  1185                                                      
REMARK 465     UNK F  1186                                                      
REMARK 465     UNK F  1187                                                      
REMARK 465     UNK F  1188                                                      
REMARK 465     UNK F  1189                                                      
REMARK 465     UNK F  1190                                                      
REMARK 465     UNK F  1191                                                      
REMARK 465     UNK F  1192                                                      
REMARK 465     UNK F  1193                                                      
REMARK 465     UNK F  1194                                                      
REMARK 465     UNK F  1195                                                      
REMARK 465     UNK F  1196                                                      
REMARK 465     UNK F  1197                                                      
REMARK 465     UNK F  1198                                                      
REMARK 465     UNK F  1199                                                      
REMARK 465     UNK F  1200                                                      
REMARK 465     UNK F  1201                                                      
REMARK 465     UNK F  1202                                                      
REMARK 465     UNK F  1203                                                      
REMARK 465     UNK F  1204                                                      
REMARK 465     UNK F  1205                                                      
REMARK 465     UNK F  1206                                                      
REMARK 465     UNK F  1207                                                      
REMARK 465     UNK F  1208                                                      
REMARK 465     UNK F  1209                                                      
REMARK 465     UNK F  1210                                                      
REMARK 465     UNK F  1211                                                      
REMARK 465     UNK F  1212                                                      
REMARK 465     UNK F  1213                                                      
REMARK 465     UNK F  1214                                                      
REMARK 465     UNK F  1215                                                      
REMARK 465     UNK F  1216                                                      
REMARK 465     UNK F  1217                                                      
REMARK 465     UNK F  1218                                                      
REMARK 465     UNK F  1219                                                      
REMARK 465     UNK F  1220                                                      
REMARK 465     UNK F  1221                                                      
REMARK 465     UNK F  1222                                                      
REMARK 465     UNK F  1223                                                      
REMARK 465     UNK F  1224                                                      
REMARK 465     UNK F  1225                                                      
REMARK 465     UNK F  1226                                                      
REMARK 465     UNK F  1227                                                      
REMARK 465     UNK F  1228                                                      
REMARK 465     UNK F  1229                                                      
REMARK 465     UNK F  1230                                                      
REMARK 465     UNK F  1231                                                      
REMARK 465     UNK F  1232                                                      
REMARK 465     UNK F  1233                                                      
REMARK 465     UNK F  1234                                                      
REMARK 465     UNK F  1235                                                      
REMARK 465     UNK F  1236                                                      
REMARK 465     UNK F  1237                                                      
REMARK 465     UNK F  1238                                                      
REMARK 465     UNK F  1239                                                      
REMARK 465     UNK F  1240                                                      
REMARK 465     UNK F  1241                                                      
REMARK 465     UNK F  1242                                                      
REMARK 465     UNK F  1243                                                      
REMARK 465     UNK F  1244                                                      
REMARK 465     UNK F  1245                                                      
REMARK 465     UNK F  1246                                                      
REMARK 465     UNK F  1247                                                      
REMARK 465     UNK F  1248                                                      
REMARK 465     UNK F  1249                                                      
REMARK 465     UNK F  1250                                                      
REMARK 465     UNK F  1251                                                      
REMARK 465     UNK F  1252                                                      
REMARK 465     UNK F  1253                                                      
REMARK 465     UNK F  1254                                                      
REMARK 465     UNK F  1255                                                      
REMARK 465     UNK F  1256                                                      
REMARK 465     UNK F  1257                                                      
REMARK 465     UNK F  1258                                                      
REMARK 465     UNK F  1259                                                      
REMARK 465     UNK F  1260                                                      
REMARK 465     UNK F  1261                                                      
REMARK 465     UNK F  1262                                                      
REMARK 465     UNK F  1263                                                      
REMARK 465     UNK F  1264                                                      
REMARK 465     UNK F  1265                                                      
REMARK 465     UNK F  1266                                                      
REMARK 465     UNK F  1267                                                      
REMARK 465     UNK F  1268                                                      
REMARK 465     UNK F  1269                                                      
REMARK 465     UNK F  1270                                                      
REMARK 465     UNK F  1271                                                      
REMARK 465     UNK F  1272                                                      
REMARK 465     UNK F  1273                                                      
REMARK 465     UNK F  1274                                                      
REMARK 465     UNK F  1275                                                      
REMARK 465     UNK F  1276                                                      
REMARK 465     UNK F  1277                                                      
REMARK 465     UNK F  1278                                                      
REMARK 465     UNK F  1279                                                      
REMARK 465     UNK F  1280                                                      
REMARK 465     UNK F  1281                                                      
REMARK 465     UNK F  1282                                                      
REMARK 465     UNK F  1283                                                      
REMARK 465     UNK F  1284                                                      
REMARK 465     UNK F  1285                                                      
REMARK 465     UNK F  1286                                                      
REMARK 465     UNK F  1287                                                      
REMARK 465     UNK F  1288                                                      
REMARK 465     UNK F  1289                                                      
REMARK 465     UNK F  1290                                                      
REMARK 465     UNK F  1291                                                      
REMARK 465     UNK F  1292                                                      
REMARK 465     UNK F  1293                                                      
REMARK 465     UNK F  1294                                                      
REMARK 465     UNK F  1295                                                      
REMARK 465     UNK F  1296                                                      
REMARK 465     UNK F  1297                                                      
REMARK 465     UNK F  1298                                                      
REMARK 465     UNK F  1299                                                      
REMARK 465     UNK F  1300                                                      
REMARK 465     UNK F  1301                                                      
REMARK 465     UNK F  1302                                                      
REMARK 465     UNK F  1303                                                      
REMARK 465     UNK F  1304                                                      
REMARK 465     UNK F  1305                                                      
REMARK 465     UNK F  1306                                                      
REMARK 465     UNK F  1307                                                      
REMARK 465     UNK F  1308                                                      
REMARK 465     UNK F  1309                                                      
REMARK 465     UNK F  1310                                                      
REMARK 465     UNK F  1311                                                      
REMARK 465     UNK F  1312                                                      
REMARK 465     UNK F  1313                                                      
REMARK 465     UNK F  1314                                                      
REMARK 465     UNK F  1315                                                      
REMARK 465     UNK F  1316                                                      
REMARK 465     UNK F  1317                                                      
REMARK 465     UNK F  1318                                                      
REMARK 465     UNK F  1319                                                      
REMARK 465     UNK F  1320                                                      
REMARK 465     UNK F  1321                                                      
REMARK 465     UNK F  1322                                                      
REMARK 465     UNK F  1323                                                      
REMARK 465     UNK F  1324                                                      
REMARK 465     UNK F  1325                                                      
REMARK 465     UNK F  1326                                                      
REMARK 465     UNK F  1327                                                      
REMARK 465     UNK F  1328                                                      
REMARK 465     UNK F  1329                                                      
REMARK 465     UNK F  1330                                                      
REMARK 465     UNK F  1331                                                      
REMARK 465     UNK F  1332                                                      
REMARK 465     UNK F  1333                                                      
REMARK 465     UNK F  1334                                                      
REMARK 465     UNK F  1335                                                      
REMARK 465     UNK F  1336                                                      
REMARK 465     UNK F  1337                                                      
REMARK 465     UNK F  1338                                                      
REMARK 465     UNK F  1339                                                      
REMARK 465     UNK F  1340                                                      
REMARK 465     UNK F  1341                                                      
REMARK 465     UNK F  1342                                                      
REMARK 465     UNK F  1343                                                      
REMARK 465     UNK F  1344                                                      
REMARK 465     UNK F  1345                                                      
REMARK 465     UNK F  1346                                                      
REMARK 465     UNK F  1347                                                      
REMARK 465     UNK F  1348                                                      
REMARK 465     UNK F  1349                                                      
REMARK 465     UNK F  1350                                                      
REMARK 465     UNK F  1351                                                      
REMARK 465     UNK F  1352                                                      
REMARK 465     UNK F  1353                                                      
REMARK 465     UNK F  1354                                                      
REMARK 465     UNK F  1355                                                      
REMARK 465     UNK F  1356                                                      
REMARK 465     UNK F  1357                                                      
REMARK 465     UNK F  1358                                                      
REMARK 465     UNK F  1359                                                      
REMARK 465     UNK F  1360                                                      
REMARK 465     UNK F  1361                                                      
REMARK 465     UNK F  1362                                                      
REMARK 465     UNK F  1363                                                      
REMARK 465     UNK F  1364                                                      
REMARK 465     UNK F  1365                                                      
REMARK 465     UNK F  1366                                                      
REMARK 465     UNK F  1367                                                      
REMARK 465     UNK F  1368                                                      
REMARK 465     UNK F  1369                                                      
REMARK 465     UNK F  1370                                                      
REMARK 465     UNK F  1371                                                      
REMARK 465     UNK F  1372                                                      
REMARK 465     UNK F  1373                                                      
REMARK 465     UNK F  1374                                                      
REMARK 465     UNK F  1375                                                      
REMARK 465     UNK F  1376                                                      
REMARK 465     UNK F  1377                                                      
REMARK 465     UNK F  1378                                                      
REMARK 465     UNK F  1379                                                      
REMARK 465     UNK F  1380                                                      
REMARK 465     UNK F  1381                                                      
REMARK 465     UNK F  1382                                                      
REMARK 465     UNK F  1383                                                      
REMARK 465     UNK F  1384                                                      
REMARK 465     UNK F  1385                                                      
REMARK 465     UNK F  1386                                                      
REMARK 465     UNK F  1387                                                      
REMARK 465     UNK F  1388                                                      
REMARK 465     UNK F  1389                                                      
REMARK 465     UNK F  1390                                                      
REMARK 465     UNK F  1391                                                      
REMARK 465     UNK F  1392                                                      
REMARK 465     UNK F  1393                                                      
REMARK 465     UNK F  1394                                                      
REMARK 465     UNK F  1395                                                      
REMARK 465     UNK F  1396                                                      
REMARK 465     UNK F  1397                                                      
REMARK 465     UNK F  1398                                                      
REMARK 465     UNK F  1399                                                      
REMARK 465     UNK F  1400                                                      
REMARK 465     UNK F  1401                                                      
REMARK 465     UNK F  1402                                                      
REMARK 465     UNK F  1403                                                      
REMARK 465     UNK F  1404                                                      
REMARK 465     UNK F  1405                                                      
REMARK 465     UNK F  1406                                                      
REMARK 465     UNK F  1407                                                      
REMARK 465     UNK F  1408                                                      
REMARK 465     UNK F  1409                                                      
REMARK 465     UNK F  1410                                                      
REMARK 465     UNK F  1411                                                      
REMARK 465     UNK F  1412                                                      
REMARK 465     UNK F  1413                                                      
REMARK 465     UNK F  1414                                                      
REMARK 465     UNK F  1415                                                      
REMARK 465     UNK F  1416                                                      
REMARK 465     UNK F  1417                                                      
REMARK 465     UNK F  1418                                                      
REMARK 465     UNK F  1419                                                      
REMARK 465     UNK F  1420                                                      
REMARK 465     UNK F  1421                                                      
REMARK 465     UNK F  1422                                                      
REMARK 465     UNK F  1423                                                      
REMARK 465     UNK F  1424                                                      
REMARK 465     UNK F  1425                                                      
REMARK 465     UNK F  1426                                                      
REMARK 465     UNK F  1427                                                      
REMARK 465     UNK F  1428                                                      
REMARK 465     UNK F  1429                                                      
REMARK 465     UNK F  1430                                                      
REMARK 465     UNK F  1431                                                      
REMARK 465     UNK F  1432                                                      
REMARK 465     UNK F  1433                                                      
REMARK 465     UNK F  1434                                                      
REMARK 465     UNK F  1435                                                      
REMARK 465     UNK F  1436                                                      
REMARK 465     UNK F  1437                                                      
REMARK 465     UNK F  1438                                                      
REMARK 465     UNK F  1439                                                      
REMARK 465     UNK F  1440                                                      
REMARK 465     UNK F  1441                                                      
REMARK 465     UNK F  1442                                                      
REMARK 465     UNK F  1443                                                      
REMARK 465     UNK F  1444                                                      
REMARK 465     UNK F  1445                                                      
REMARK 465     UNK F  1446                                                      
REMARK 465     UNK F  1447                                                      
REMARK 465     UNK F  1448                                                      
REMARK 465     UNK F  1449                                                      
REMARK 465     UNK F  1450                                                      
REMARK 465     UNK F  1451                                                      
REMARK 465     UNK F  1452                                                      
REMARK 465     UNK F  1453                                                      
REMARK 465     UNK F  1454                                                      
REMARK 465     UNK F  1455                                                      
REMARK 465     UNK F  1456                                                      
REMARK 465     UNK F  1457                                                      
REMARK 465     UNK F  1458                                                      
REMARK 465     UNK F  1459                                                      
REMARK 465     UNK F  1460                                                      
REMARK 465     UNK F  1461                                                      
REMARK 465     UNK F  1462                                                      
REMARK 465     UNK F  1463                                                      
REMARK 465     UNK F  1464                                                      
REMARK 465     UNK F  1465                                                      
REMARK 465     UNK F  1466                                                      
REMARK 465     UNK F  1467                                                      
REMARK 465     UNK F  1468                                                      
REMARK 465     UNK F  1469                                                      
REMARK 465     UNK F  1470                                                      
REMARK 465     UNK F  1471                                                      
REMARK 465     UNK F  1472                                                      
REMARK 465     UNK F  1473                                                      
REMARK 465     UNK F  1474                                                      
REMARK 465     UNK F  1475                                                      
REMARK 465     UNK F  1476                                                      
REMARK 465     UNK F  1477                                                      
REMARK 465     UNK F  1478                                                      
REMARK 465     UNK F  1479                                                      
REMARK 465     UNK F  1480                                                      
REMARK 465     UNK F  1481                                                      
REMARK 465     UNK F  1482                                                      
REMARK 465     UNK F  1483                                                      
REMARK 465     UNK F  1484                                                      
REMARK 465     UNK F  1485                                                      
REMARK 465     UNK F  1486                                                      
REMARK 465     UNK F  1487                                                      
REMARK 465     UNK F  1488                                                      
REMARK 465     UNK F  1489                                                      
REMARK 465     UNK F  1490                                                      
REMARK 465     UNK F  1491                                                      
REMARK 465     UNK F  1492                                                      
REMARK 465     UNK F  1493                                                      
REMARK 465     UNK F  1494                                                      
REMARK 465     UNK F  1495                                                      
REMARK 465     UNK F  1496                                                      
REMARK 465     UNK F  1497                                                      
REMARK 465     UNK F  1498                                                      
REMARK 465     UNK F  1499                                                      
REMARK 465     UNK F  1500                                                      
REMARK 465     UNK F  1501                                                      
REMARK 465     UNK F  1502                                                      
REMARK 465     UNK F  1503                                                      
REMARK 465     UNK F  1504                                                      
REMARK 465     UNK F  1505                                                      
REMARK 465     UNK F  1506                                                      
REMARK 465     UNK F  1507                                                      
REMARK 465     UNK F  1508                                                      
REMARK 465     UNK F  1509                                                      
REMARK 465     UNK F  1510                                                      
REMARK 465     UNK F  1511                                                      
REMARK 465     UNK F  1512                                                      
REMARK 465     UNK F  1513                                                      
REMARK 465     UNK F  1514                                                      
REMARK 465     UNK F  1515                                                      
REMARK 465     UNK F  1516                                                      
REMARK 465     UNK F  1517                                                      
REMARK 465     UNK F  1518                                                      
REMARK 465     UNK F  1519                                                      
REMARK 465     UNK F  1520                                                      
REMARK 465     UNK F  1521                                                      
REMARK 465     UNK F  1522                                                      
REMARK 465     UNK F  1523                                                      
REMARK 465     UNK F  1524                                                      
REMARK 465     UNK F  1525                                                      
REMARK 465     UNK F  1526                                                      
REMARK 465     UNK F  1527                                                      
REMARK 465     UNK F  1528                                                      
REMARK 465     UNK F  1529                                                      
REMARK 465     UNK F  1530                                                      
REMARK 465     UNK F  1531                                                      
REMARK 465     UNK F  1532                                                      
REMARK 465     UNK F  1533                                                      
REMARK 465     UNK F  1534                                                      
REMARK 465     UNK F  1535                                                      
REMARK 465     UNK F  1536                                                      
REMARK 465     UNK F  1537                                                      
REMARK 465     UNK F  1538                                                      
REMARK 465     UNK F  1539                                                      
REMARK 465     UNK F  1540                                                      
REMARK 465     UNK F  1541                                                      
REMARK 465     UNK F  1542                                                      
REMARK 465     UNK F  1543                                                      
REMARK 465     UNK F  1544                                                      
REMARK 465     UNK F  1545                                                      
REMARK 465     UNK F  1546                                                      
REMARK 465     UNK F  1547                                                      
REMARK 465     UNK F  1548                                                      
REMARK 465     UNK F  1549                                                      
REMARK 465     UNK F  1550                                                      
REMARK 465     UNK F  1551                                                      
REMARK 465     UNK F  1552                                                      
REMARK 465     UNK F  1553                                                      
REMARK 465     UNK F  1554                                                      
REMARK 465     UNK F  1555                                                      
REMARK 465     UNK F  1556                                                      
REMARK 465     UNK F  1557                                                      
REMARK 465     UNK F  1558                                                      
REMARK 465     UNK F  1559                                                      
REMARK 465     UNK F  1560                                                      
REMARK 465     UNK F  1561                                                      
REMARK 465     UNK F  1562                                                      
REMARK 465     UNK F  1563                                                      
REMARK 465     UNK F  1564                                                      
REMARK 465     UNK F  1565                                                      
REMARK 465     UNK F  1566                                                      
REMARK 465     UNK F  1567                                                      
REMARK 465     UNK F  1568                                                      
REMARK 465     UNK F  1569                                                      
REMARK 465     UNK F  1570                                                      
REMARK 465     UNK F  1571                                                      
REMARK 465     UNK F  1572                                                      
REMARK 465     UNK F  1573                                                      
REMARK 465     UNK F  1574                                                      
REMARK 465     UNK F  1575                                                      
REMARK 465     UNK F  1576                                                      
REMARK 465     UNK F  1577                                                      
REMARK 465     UNK F  1578                                                      
REMARK 465     UNK F  1579                                                      
REMARK 465     UNK F  1580                                                      
REMARK 465     UNK F  1581                                                      
REMARK 465     UNK F  1582                                                      
REMARK 465     UNK F  1583                                                      
REMARK 465     UNK F  1584                                                      
REMARK 465     UNK F  1585                                                      
REMARK 465     UNK F  1586                                                      
REMARK 465     UNK F  1587                                                      
REMARK 465     UNK F  1588                                                      
REMARK 465     UNK F  1589                                                      
REMARK 465     UNK F  1590                                                      
REMARK 465     UNK F  1591                                                      
REMARK 465     UNK F  1592                                                      
REMARK 465     UNK F  1593                                                      
REMARK 465     UNK F  1594                                                      
REMARK 465     UNK F  1595                                                      
REMARK 465     UNK F  1596                                                      
REMARK 465     UNK F  1597                                                      
REMARK 465     UNK F  1598                                                      
REMARK 465     UNK F  1599                                                      
REMARK 465     UNK F  1600                                                      
REMARK 465     UNK F  1601                                                      
REMARK 465     UNK F  1602                                                      
REMARK 465     UNK F  1603                                                      
REMARK 465     UNK F  1604                                                      
REMARK 465     UNK F  1605                                                      
REMARK 465     UNK F  1606                                                      
REMARK 465     UNK F  1607                                                      
REMARK 465     UNK F  1608                                                      
REMARK 465     UNK F  1609                                                      
REMARK 465     UNK F  1627                                                      
REMARK 465     UNK F  1628                                                      
REMARK 465     UNK F  1629                                                      
REMARK 465     UNK F  1650                                                      
REMARK 465     UNK F  1651                                                      
REMARK 465     UNK F  1652                                                      
REMARK 465     UNK F  1653                                                      
REMARK 465     UNK F  1654                                                      
REMARK 465     UNK F  1655                                                      
REMARK 465     UNK F  1656                                                      
REMARK 465     UNK F  1657                                                      
REMARK 465     UNK F  1658                                                      
REMARK 465     UNK F  1659                                                      
REMARK 465     UNK F  1660                                                      
REMARK 465     UNK F  1661                                                      
REMARK 465     UNK F  1662                                                      
REMARK 465     UNK F  1663                                                      
REMARK 465     UNK F  1664                                                      
REMARK 465     UNK F  1665                                                      
REMARK 465     UNK F  1666                                                      
REMARK 465     UNK F  1667                                                      
REMARK 465     UNK F  1668                                                      
REMARK 465     UNK F  1669                                                      
REMARK 465     UNK F  1670                                                      
REMARK 465     UNK F  1671                                                      
REMARK 465     UNK F  1672                                                      
REMARK 465     UNK F  1673                                                      
REMARK 465     UNK F  1674                                                      
REMARK 465     UNK F  1675                                                      
REMARK 465     UNK F  1676                                                      
REMARK 465     UNK F  1677                                                      
REMARK 465     UNK F  1678                                                      
REMARK 465     UNK F  1679                                                      
REMARK 465     UNK F  1696                                                      
REMARK 465     UNK F  1697                                                      
REMARK 465     UNK F  1698                                                      
REMARK 465     UNK F  1699                                                      
REMARK 465     UNK F  1700                                                      
REMARK 465     UNK F  1701                                                      
REMARK 465     UNK F  1702                                                      
REMARK 465     UNK F  1703                                                      
REMARK 465     UNK F  1704                                                      
REMARK 465     UNK F  1705                                                      
REMARK 465     UNK F  1706                                                      
REMARK 465     UNK F  1707                                                      
REMARK 465     UNK F  1708                                                      
REMARK 465     UNK G     1                                                      
REMARK 465     UNK G     2                                                      
REMARK 465     UNK G     3                                                      
REMARK 465     UNK G     4                                                      
REMARK 465     UNK G     5                                                      
REMARK 465     UNK G    21                                                      
REMARK 465     UNK G    22                                                      
REMARK 465     UNK G    23                                                      
REMARK 465     UNK G    60                                                      
REMARK 465     UNK G    61                                                      
REMARK 465     UNK G    62                                                      
REMARK 465     UNK G    63                                                      
REMARK 465     UNK G    64                                                      
REMARK 465     UNK G    79                                                      
REMARK 465     UNK G    80                                                      
REMARK 465     UNK G    81                                                      
REMARK 465     UNK G    82                                                      
REMARK 465     UNK G    83                                                      
REMARK 465     UNK G    84                                                      
REMARK 465     UNK G    85                                                      
REMARK 465     UNK G   107                                                      
REMARK 465     UNK G   108                                                      
REMARK 465     UNK G   109                                                      
REMARK 465     UNK G   110                                                      
REMARK 465     UNK G   111                                                      
REMARK 465     UNK G   112                                                      
REMARK 465     UNK G   113                                                      
REMARK 465     UNK G   114                                                      
REMARK 465     UNK G   115                                                      
REMARK 465     UNK G   116                                                      
REMARK 465     UNK G   117                                                      
REMARK 465     UNK G   118                                                      
REMARK 465     UNK G   119                                                      
REMARK 465     UNK G   120                                                      
REMARK 465     UNK G   121                                                      
REMARK 465     UNK G   122                                                      
REMARK 465     UNK G   123                                                      
REMARK 465     UNK G   124                                                      
REMARK 465     UNK G   125                                                      
REMARK 465     UNK G   126                                                      
REMARK 465     UNK G   127                                                      
REMARK 465     UNK G   128                                                      
REMARK 465     UNK G   129                                                      
REMARK 465     UNK G   130                                                      
REMARK 465     UNK G   131                                                      
REMARK 465     UNK G   132                                                      
REMARK 465     UNK G   133                                                      
REMARK 465     UNK G   134                                                      
REMARK 465     UNK G   135                                                      
REMARK 465     UNK G   136                                                      
REMARK 465     UNK G   137                                                      
REMARK 465     UNK G   138                                                      
REMARK 465     UNK G   139                                                      
REMARK 465     UNK G   140                                                      
REMARK 465     ILE G   141                                                      
REMARK 465     LEU G   142                                                      
REMARK 465     SER G   143                                                      
REMARK 465     VAL G   144                                                      
REMARK 465     ARG G   145                                                      
REMARK 465     LEU G   146                                                      
REMARK 465     GLU G   147                                                      
REMARK 465     GLN G   148                                                      
REMARK 465     CYS G   149                                                      
REMARK 465     PRO G   150                                                      
REMARK 465     LEU G   151                                                      
REMARK 465     GLN G   152                                                      
REMARK 465     LEU G   153                                                      
REMARK 465     ASN G   154                                                      
REMARK 465     ASN G   155                                                      
REMARK 465     PRO G   156                                                      
REMARK 465     PHE G   157                                                      
REMARK 465     ASN G   158                                                      
REMARK 465     GLU G   159                                                      
REMARK 465     TYR G   160                                                      
REMARK 465     SER G   161                                                      
REMARK 465     LYS G   162                                                      
REMARK 465     PHE G   163                                                      
REMARK 465     ASP G   164                                                      
REMARK 465     GLY G   165                                                      
REMARK 465     LYS G   166                                                      
REMARK 465     GLY G   167                                                      
REMARK 465     HIS G   168                                                      
REMARK 465     VAL G   169                                                      
REMARK 465     GLY G   170                                                      
REMARK 465     THR G   171                                                      
REMARK 465     THR G   172                                                      
REMARK 465     ALA G   173                                                      
REMARK 465     THR G   174                                                      
REMARK 465     LYS G   175                                                      
REMARK 465     LYS G   176                                                      
REMARK 465     ILE G   177                                                      
REMARK 465     ASP G   178                                                      
REMARK 465     VAL G   179                                                      
REMARK 465     TYR G   180                                                      
REMARK 465     LEU G   181                                                      
REMARK 465     PRO G   182                                                      
REMARK 465     LEU G   183                                                      
REMARK 465     HIS G   184                                                      
REMARK 465     SER G   185                                                      
REMARK 465     SER G   186                                                      
REMARK 465     GLN G   187                                                      
REMARK 465     ASP G   188                                                      
REMARK 465     ARG G   189                                                      
REMARK 465     LEU G   190                                                      
REMARK 465     LEU G   191                                                      
REMARK 465     PRO G   192                                                      
REMARK 465     MET G   193                                                      
REMARK 465     THR G   194                                                      
REMARK 465     VAL G   195                                                      
REMARK 465     VAL G   196                                                      
REMARK 465     THR G   197                                                      
REMARK 465     MET G   198                                                      
REMARK 465     ALA G   199                                                      
REMARK 465     SER G   200                                                      
REMARK 465     ALA G   201                                                      
REMARK 465     ARG G   202                                                      
REMARK 465     VAL G   203                                                      
REMARK 465     GLN G   204                                                      
REMARK 465     ASP G   205                                                      
REMARK 465     LEU G   206                                                      
REMARK 465     ILE G   207                                                      
REMARK 465     GLY G   208                                                      
REMARK 465     LEU G   209                                                      
REMARK 465     ILE G   210                                                      
REMARK 465     CYS G   211                                                      
REMARK 465     TRP G   212                                                      
REMARK 465     GLN G   213                                                      
REMARK 465     TYR G   214                                                      
REMARK 465     THR G   215                                                      
REMARK 465     SER G   216                                                      
REMARK 465     GLU G   217                                                      
REMARK 465     GLY G   218                                                      
REMARK 465     ARG G   219                                                      
REMARK 465     GLU G   220                                                      
REMARK 465     PRO G   221                                                      
REMARK 465     LYS G   222                                                      
REMARK 465     LEU G   223                                                      
REMARK 465     ASN G   224                                                      
REMARK 465     ASP G   225                                                      
REMARK 465     ASN G   226                                                      
REMARK 465     VAL G   227                                                      
REMARK 465     SER G   228                                                      
REMARK 465     ALA G   229                                                      
REMARK 465     TYR G   230                                                      
REMARK 465     CYS G   231                                                      
REMARK 465     LEU G   232                                                      
REMARK 465     HIS G   233                                                      
REMARK 465     ILE G   234                                                      
REMARK 465     ALA G   235                                                      
REMARK 465     GLU G   236                                                      
REMARK 465     ASP G   237                                                      
REMARK 465     ASP G   238                                                      
REMARK 465     GLY G   239                                                      
REMARK 465     GLU G   240                                                      
REMARK 465     VAL G   241                                                      
REMARK 465     ASP G   242                                                      
REMARK 465     THR G   243                                                      
REMARK 465     ASP G   244                                                      
REMARK 465     PHE G   245                                                      
REMARK 465     PRO G   246                                                      
REMARK 465     PRO G   247                                                      
REMARK 465     LEU G   248                                                      
REMARK 465     ASP G   249                                                      
REMARK 465     SER G   250                                                      
REMARK 465     ASN G   251                                                      
REMARK 465     GLU G   252                                                      
REMARK 465     PRO G   253                                                      
REMARK 465     ILE G   254                                                      
REMARK 465     HIS G   255                                                      
REMARK 465     LYS G   256                                                      
REMARK 465     PHE G   257                                                      
REMARK 465     GLY G   258                                                      
REMARK 465     PHE G   259                                                      
REMARK 465     SER G   260                                                      
REMARK 465     THR G   261                                                      
REMARK 465     LEU G   262                                                      
REMARK 465     ALA G   263                                                      
REMARK 465     LEU G   264                                                      
REMARK 465     VAL G   265                                                      
REMARK 465     GLU G   266                                                      
REMARK 465     LYS G   267                                                      
REMARK 465     TYR G   268                                                      
REMARK 465     SER G   269                                                      
REMARK 465     SER G   270                                                      
REMARK 465     PRO G   271                                                      
REMARK 465     GLY G   272                                                      
REMARK 465     LEU G   273                                                      
REMARK 465     THR G   274                                                      
REMARK 465     SER G   275                                                      
REMARK 465     LYS G   276                                                      
REMARK 465     GLU G   277                                                      
REMARK 465     SER G   278                                                      
REMARK 465     LEU G   279                                                      
REMARK 465     PHE G   280                                                      
REMARK 465     VAL G   281                                                      
REMARK 465     ARG G   282                                                      
REMARK 465     ILE G   283                                                      
REMARK 465     ASN G   284                                                      
REMARK 465     ALA G   285                                                      
REMARK 465     ALA G   286                                                      
REMARK 465     HIS G   287                                                      
REMARK 465     GLY G   288                                                      
REMARK 465     PHE G   289                                                      
REMARK 465     SER G   290                                                      
REMARK 465     LEU G   291                                                      
REMARK 465     ILE G   292                                                      
REMARK 465     GLN G   293                                                      
REMARK 465     VAL G   294                                                      
REMARK 465     ASP G   295                                                      
REMARK 465     ASN G   296                                                      
REMARK 465     THR G   297                                                      
REMARK 465     LYS G   298                                                      
REMARK 465     VAL G   299                                                      
REMARK 465     THR G   300                                                      
REMARK 465     MET G   301                                                      
REMARK 465     LYS G   302                                                      
REMARK 465     GLU G   303                                                      
REMARK 465     ILE G   304                                                      
REMARK 465     LEU G   305                                                      
REMARK 465     LEU G   306                                                      
REMARK 465     LYS G   307                                                      
REMARK 465     ALA G   308                                                      
REMARK 465     VAL G   309                                                      
REMARK 465     LYS G   310                                                      
REMARK 465     ARG G   311                                                      
REMARK 465     ARG G   312                                                      
REMARK 465     LYS G   313                                                      
REMARK 465     GLY G   314                                                      
REMARK 465     SER G   315                                                      
REMARK 465     GLN G   316                                                      
REMARK 465     LYS G   317                                                      
REMARK 465     VAL G   318                                                      
REMARK 465     SER G   319                                                      
REMARK 465     GLY G   320                                                      
REMARK 465     PRO G   321                                                      
REMARK 465     GLN G   322                                                      
REMARK 465     TYR G   323                                                      
REMARK 465     ARG G   324                                                      
REMARK 465     LEU G   325                                                      
REMARK 465     GLU G   326                                                      
REMARK 465     LYS G   327                                                      
REMARK 465     GLN G   328                                                      
REMARK 465     SER G   329                                                      
REMARK 465     GLU G   330                                                      
REMARK 465     PRO G   331                                                      
REMARK 465     ASN G   332                                                      
REMARK 465     VAL G   333                                                      
REMARK 465     ALA G   334                                                      
REMARK 465     VAL G   335                                                      
REMARK 465     ASP G   336                                                      
REMARK 465     LEU G   337                                                      
REMARK 465     ASP G   338                                                      
REMARK 465     SER G   339                                                      
REMARK 465     THR G   340                                                      
REMARK 465     LEU G   341                                                      
REMARK 465     GLU G   342                                                      
REMARK 465     SER G   343                                                      
REMARK 465     GLN G   344                                                      
REMARK 465     SER G   345                                                      
REMARK 465     ALA G   346                                                      
REMARK 465     TRP G   347                                                      
REMARK 465     GLU G   348                                                      
REMARK 465     PHE G   349                                                      
REMARK 465     CYS G   350                                                      
REMARK 465     LEU G   351                                                      
REMARK 465     VAL G   352                                                      
REMARK 465     ARG G   353                                                      
REMARK 465     GLU G   354                                                      
REMARK 465     ASN G   355                                                      
REMARK 465     SER G   356                                                      
REMARK 465     SER G   357                                                      
REMARK 465     ARG G   358                                                      
REMARK 465     ALA G   359                                                      
REMARK 465     ASP G   360                                                      
REMARK 465     GLY G   361                                                      
REMARK 465     VAL G   362                                                      
REMARK 465     PHE G   363                                                      
REMARK 465     GLU G   364                                                      
REMARK 465     GLU G   365                                                      
REMARK 465     ASP G   366                                                      
REMARK 465     SER G   367                                                      
REMARK 465     GLN G   368                                                      
REMARK 465     ILE G   369                                                      
REMARK 465     ASP G   370                                                      
REMARK 465     ILE G   371                                                      
REMARK 465     ALA G   372                                                      
REMARK 465     THR G   373                                                      
REMARK 465     VAL G   374                                                      
REMARK 465     GLN G   375                                                      
REMARK 465     ASP G   376                                                      
REMARK 465     MET G   377                                                      
REMARK 465     LEU G   378                                                      
REMARK 465     SER G   379                                                      
REMARK 465     SER G   380                                                      
REMARK 465     HIS G   381                                                      
REMARK 465     HIS G   382                                                      
REMARK 465     TYR G   383                                                      
REMARK 465     LYS G   384                                                      
REMARK 465     SER G   385                                                      
REMARK 465     PHE G   386                                                      
REMARK 465     LYS G   387                                                      
REMARK 465     VAL G   388                                                      
REMARK 465     SER G   389                                                      
REMARK 465     MET G   390                                                      
REMARK 465     ILE G   391                                                      
REMARK 465     HIS G   392                                                      
REMARK 465     ARG G   393                                                      
REMARK 465     LEU G   394                                                      
REMARK 465     ARG G   395                                                      
REMARK 465     PHE G   396                                                      
REMARK 465     THR G   397                                                      
REMARK 465     THR G   398                                                      
REMARK 465     ASP G   399                                                      
REMARK 465     VAL G   400                                                      
REMARK 465     GLN G   401                                                      
REMARK 465     LEU G   402                                                      
REMARK 465     GLY G   403                                                      
REMARK 465     ILE G   404                                                      
REMARK 465     SER G   405                                                      
REMARK 465     GLY G   406                                                      
REMARK 465     ASP G   407                                                      
REMARK 465     LYS G   408                                                      
REMARK 465     VAL G   409                                                      
REMARK 465     GLU G   410                                                      
REMARK 465     ILE G   411                                                      
REMARK 465     ASP G   412                                                      
REMARK 465     PRO G   413                                                      
REMARK 465     VAL G   414                                                      
REMARK 465     THR G   415                                                      
REMARK 465     ASN G   416                                                      
REMARK 465     GLN G   417                                                      
REMARK 465     LYS G   418                                                      
REMARK 465     ALA G   419                                                      
REMARK 465     SER G   420                                                      
REMARK 465     THR G   421                                                      
REMARK 465     LYS G   422                                                      
REMARK 465     PHE G   423                                                      
REMARK 465     TRP G   424                                                      
REMARK 465     ILE G   425                                                      
REMARK 465     LYS G   426                                                      
REMARK 465     GLN G   427                                                      
REMARK 465     LYS G   428                                                      
REMARK 465     PRO G   429                                                      
REMARK 465     ILE G   430                                                      
REMARK 465     SER G   431                                                      
REMARK 465     ILE G   432                                                      
REMARK 465     ASP G   433                                                      
REMARK 465     SER G   434                                                      
REMARK 465     ASP G   435                                                      
REMARK 465     LEU G   436                                                      
REMARK 465     LEU G   437                                                      
REMARK 465     CYS G   438                                                      
REMARK 465     ALA G   439                                                      
REMARK 465     CYS G   440                                                      
REMARK 465     ASP G   441                                                      
REMARK 465     LEU G   442                                                      
REMARK 465     ALA G   443                                                      
REMARK 465     GLU G   444                                                      
REMARK 465     GLU G   445                                                      
REMARK 465     LYS G   446                                                      
REMARK 465     SER G   447                                                      
REMARK 465     PRO G   448                                                      
REMARK 465     SER G   449                                                      
REMARK 465     HIS G   450                                                      
REMARK 465     ALA G   451                                                      
REMARK 465     ILE G   452                                                      
REMARK 465     PHE G   453                                                      
REMARK 465     LYS G   454                                                      
REMARK 465     LEU G   455                                                      
REMARK 465     THR G   456                                                      
REMARK 465     TYR G   457                                                      
REMARK 465     LEU G   458                                                      
REMARK 465     SER G   459                                                      
REMARK 465     ASN G   460                                                      
REMARK 465     HIS G   461                                                      
REMARK 465     ASP G   462                                                      
REMARK 465     TYR G   463                                                      
REMARK 465     LYS G   464                                                      
REMARK 465     HIS G   465                                                      
REMARK 465     LEU G   466                                                      
REMARK 465     TYR G   467                                                      
REMARK 465     PHE G   468                                                      
REMARK 465     GLU G   469                                                      
REMARK 465     SER G   470                                                      
REMARK 465     ASP G   471                                                      
REMARK 465     ALA G   472                                                      
REMARK 465     ALA G   473                                                      
REMARK 465     THR G   474                                                      
REMARK 465     VAL G   475                                                      
REMARK 465     ASN G   476                                                      
REMARK 465     GLU G   477                                                      
REMARK 465     ILE G   478                                                      
REMARK 465     VAL G   479                                                      
REMARK 465     LEU G   480                                                      
REMARK 465     LYS G   481                                                      
REMARK 465     VAL G   482                                                      
REMARK 465     ASN G   483                                                      
REMARK 465     TYR G   484                                                      
REMARK 465     ILE G   485                                                      
REMARK 465     LEU G   486                                                      
REMARK 465     GLU G   487                                                      
REMARK 465     SER G   488                                                      
REMARK 465     ARG G   489                                                      
REMARK 465     ALA G   490                                                      
REMARK 465     SER G   491                                                      
REMARK 465     THR G   492                                                      
REMARK 465     ALA G   493                                                      
REMARK 465     ARG G   494                                                      
REMARK 465     ALA G   495                                                      
REMARK 465     ASP G   496                                                      
REMARK 465     TYR G   497                                                      
REMARK 465     PHE G   498                                                      
REMARK 465     ALA G   499                                                      
REMARK 465     GLN G   500                                                      
REMARK 465     LYS G   501                                                      
REMARK 465     GLN G   502                                                      
REMARK 465     ARG G   503                                                      
REMARK 465     LYS G   504                                                      
REMARK 465     LEU G   505                                                      
REMARK 465     ASN G   506                                                      
REMARK 465     ARG G   507                                                      
REMARK 465     ARG G   508                                                      
REMARK 465     THR G   509                                                      
REMARK 465     SER G   510                                                      
REMARK 465     PHE G   511                                                      
REMARK 465     SER G   512                                                      
REMARK 465     PHE G   513                                                      
REMARK 465     GLN G   514                                                      
REMARK 465     LYS G   515                                                      
REMARK 465     GLU G   516                                                      
REMARK 465     LYS G   517                                                      
REMARK 465     LYS G   518                                                      
REMARK 465     SER G   519                                                      
REMARK 465     GLY G   520                                                      
REMARK 465     GLN G   521                                                      
REMARK 465     GLN G   522                                                      
REMARK 465     UNK H     1                                                      
REMARK 465     UNK H     2                                                      
REMARK 465     UNK H     3                                                      
REMARK 465     UNK H     4                                                      
REMARK 465     UNK H     5                                                      
REMARK 465     UNK H    21                                                      
REMARK 465     UNK H    22                                                      
REMARK 465     UNK H    23                                                      
REMARK 465     UNK H    60                                                      
REMARK 465     UNK H    61                                                      
REMARK 465     UNK H    62                                                      
REMARK 465     UNK H    63                                                      
REMARK 465     UNK H    64                                                      
REMARK 465     UNK H    79                                                      
REMARK 465     UNK H    80                                                      
REMARK 465     UNK H    81                                                      
REMARK 465     UNK H    82                                                      
REMARK 465     UNK H    83                                                      
REMARK 465     UNK H    84                                                      
REMARK 465     UNK H    85                                                      
REMARK 465     UNK H   107                                                      
REMARK 465     UNK H   108                                                      
REMARK 465     UNK H   109                                                      
REMARK 465     UNK H   110                                                      
REMARK 465     UNK H   111                                                      
REMARK 465     UNK H   112                                                      
REMARK 465     UNK H   113                                                      
REMARK 465     UNK H   114                                                      
REMARK 465     UNK H   115                                                      
REMARK 465     UNK H   116                                                      
REMARK 465     UNK H   117                                                      
REMARK 465     UNK H   118                                                      
REMARK 465     UNK H   119                                                      
REMARK 465     UNK H   120                                                      
REMARK 465     UNK H   121                                                      
REMARK 465     UNK H   122                                                      
REMARK 465     UNK H   123                                                      
REMARK 465     UNK H   124                                                      
REMARK 465     UNK H   125                                                      
REMARK 465     UNK H   126                                                      
REMARK 465     UNK H   127                                                      
REMARK 465     UNK H   128                                                      
REMARK 465     UNK H   129                                                      
REMARK 465     UNK H   130                                                      
REMARK 465     UNK H   131                                                      
REMARK 465     UNK H   132                                                      
REMARK 465     UNK H   133                                                      
REMARK 465     UNK H   134                                                      
REMARK 465     UNK H   135                                                      
REMARK 465     UNK H   136                                                      
REMARK 465     UNK H   137                                                      
REMARK 465     UNK H   138                                                      
REMARK 465     UNK H   139                                                      
REMARK 465     UNK H   140                                                      
REMARK 465     ILE H   141                                                      
REMARK 465     LEU H   142                                                      
REMARK 465     SER H   143                                                      
REMARK 465     VAL H   144                                                      
REMARK 465     ARG H   145                                                      
REMARK 465     LEU H   146                                                      
REMARK 465     GLU H   147                                                      
REMARK 465     GLN H   148                                                      
REMARK 465     CYS H   149                                                      
REMARK 465     PRO H   150                                                      
REMARK 465     LEU H   151                                                      
REMARK 465     GLN H   152                                                      
REMARK 465     LEU H   153                                                      
REMARK 465     ASN H   154                                                      
REMARK 465     ASN H   155                                                      
REMARK 465     PRO H   156                                                      
REMARK 465     PHE H   157                                                      
REMARK 465     ASN H   158                                                      
REMARK 465     GLU H   159                                                      
REMARK 465     TYR H   160                                                      
REMARK 465     SER H   161                                                      
REMARK 465     LYS H   162                                                      
REMARK 465     PHE H   163                                                      
REMARK 465     ASP H   164                                                      
REMARK 465     GLY H   165                                                      
REMARK 465     LYS H   166                                                      
REMARK 465     GLY H   167                                                      
REMARK 465     HIS H   168                                                      
REMARK 465     VAL H   169                                                      
REMARK 465     GLY H   170                                                      
REMARK 465     THR H   171                                                      
REMARK 465     THR H   172                                                      
REMARK 465     ALA H   173                                                      
REMARK 465     THR H   174                                                      
REMARK 465     LYS H   175                                                      
REMARK 465     LYS H   176                                                      
REMARK 465     ILE H   177                                                      
REMARK 465     ASP H   178                                                      
REMARK 465     VAL H   179                                                      
REMARK 465     TYR H   180                                                      
REMARK 465     LEU H   181                                                      
REMARK 465     PRO H   182                                                      
REMARK 465     LEU H   183                                                      
REMARK 465     HIS H   184                                                      
REMARK 465     SER H   185                                                      
REMARK 465     SER H   186                                                      
REMARK 465     GLN H   187                                                      
REMARK 465     ASP H   188                                                      
REMARK 465     ARG H   189                                                      
REMARK 465     LEU H   190                                                      
REMARK 465     LEU H   191                                                      
REMARK 465     PRO H   192                                                      
REMARK 465     MET H   193                                                      
REMARK 465     THR H   194                                                      
REMARK 465     VAL H   195                                                      
REMARK 465     VAL H   196                                                      
REMARK 465     THR H   197                                                      
REMARK 465     MET H   198                                                      
REMARK 465     ALA H   199                                                      
REMARK 465     SER H   200                                                      
REMARK 465     ALA H   201                                                      
REMARK 465     ARG H   202                                                      
REMARK 465     VAL H   203                                                      
REMARK 465     GLN H   204                                                      
REMARK 465     ASP H   205                                                      
REMARK 465     LEU H   206                                                      
REMARK 465     ILE H   207                                                      
REMARK 465     GLY H   208                                                      
REMARK 465     LEU H   209                                                      
REMARK 465     ILE H   210                                                      
REMARK 465     CYS H   211                                                      
REMARK 465     TRP H   212                                                      
REMARK 465     GLN H   213                                                      
REMARK 465     TYR H   214                                                      
REMARK 465     THR H   215                                                      
REMARK 465     SER H   216                                                      
REMARK 465     GLU H   217                                                      
REMARK 465     GLY H   218                                                      
REMARK 465     ARG H   219                                                      
REMARK 465     GLU H   220                                                      
REMARK 465     PRO H   221                                                      
REMARK 465     LYS H   222                                                      
REMARK 465     LEU H   223                                                      
REMARK 465     ASN H   224                                                      
REMARK 465     ASP H   225                                                      
REMARK 465     ASN H   226                                                      
REMARK 465     VAL H   227                                                      
REMARK 465     SER H   228                                                      
REMARK 465     ALA H   229                                                      
REMARK 465     TYR H   230                                                      
REMARK 465     CYS H   231                                                      
REMARK 465     LEU H   232                                                      
REMARK 465     HIS H   233                                                      
REMARK 465     ILE H   234                                                      
REMARK 465     ALA H   235                                                      
REMARK 465     GLU H   236                                                      
REMARK 465     ASP H   237                                                      
REMARK 465     ASP H   238                                                      
REMARK 465     GLY H   239                                                      
REMARK 465     GLU H   240                                                      
REMARK 465     VAL H   241                                                      
REMARK 465     ASP H   242                                                      
REMARK 465     THR H   243                                                      
REMARK 465     ASP H   244                                                      
REMARK 465     PHE H   245                                                      
REMARK 465     PRO H   246                                                      
REMARK 465     PRO H   247                                                      
REMARK 465     LEU H   248                                                      
REMARK 465     ASP H   249                                                      
REMARK 465     SER H   250                                                      
REMARK 465     ASN H   251                                                      
REMARK 465     GLU H   252                                                      
REMARK 465     PRO H   253                                                      
REMARK 465     ILE H   254                                                      
REMARK 465     HIS H   255                                                      
REMARK 465     LYS H   256                                                      
REMARK 465     PHE H   257                                                      
REMARK 465     GLY H   258                                                      
REMARK 465     PHE H   259                                                      
REMARK 465     SER H   260                                                      
REMARK 465     THR H   261                                                      
REMARK 465     LEU H   262                                                      
REMARK 465     ALA H   263                                                      
REMARK 465     LEU H   264                                                      
REMARK 465     VAL H   265                                                      
REMARK 465     GLU H   266                                                      
REMARK 465     LYS H   267                                                      
REMARK 465     TYR H   268                                                      
REMARK 465     SER H   269                                                      
REMARK 465     SER H   270                                                      
REMARK 465     PRO H   271                                                      
REMARK 465     GLY H   272                                                      
REMARK 465     LEU H   273                                                      
REMARK 465     THR H   274                                                      
REMARK 465     SER H   275                                                      
REMARK 465     LYS H   276                                                      
REMARK 465     GLU H   277                                                      
REMARK 465     SER H   278                                                      
REMARK 465     LEU H   279                                                      
REMARK 465     PHE H   280                                                      
REMARK 465     VAL H   281                                                      
REMARK 465     ARG H   282                                                      
REMARK 465     ILE H   283                                                      
REMARK 465     ASN H   284                                                      
REMARK 465     ALA H   285                                                      
REMARK 465     ALA H   286                                                      
REMARK 465     HIS H   287                                                      
REMARK 465     GLY H   288                                                      
REMARK 465     PHE H   289                                                      
REMARK 465     SER H   290                                                      
REMARK 465     LEU H   291                                                      
REMARK 465     ILE H   292                                                      
REMARK 465     GLN H   293                                                      
REMARK 465     VAL H   294                                                      
REMARK 465     ASP H   295                                                      
REMARK 465     ASN H   296                                                      
REMARK 465     THR H   297                                                      
REMARK 465     LYS H   298                                                      
REMARK 465     VAL H   299                                                      
REMARK 465     THR H   300                                                      
REMARK 465     MET H   301                                                      
REMARK 465     LYS H   302                                                      
REMARK 465     GLU H   303                                                      
REMARK 465     ILE H   304                                                      
REMARK 465     LEU H   305                                                      
REMARK 465     LEU H   306                                                      
REMARK 465     LYS H   307                                                      
REMARK 465     ALA H   308                                                      
REMARK 465     VAL H   309                                                      
REMARK 465     LYS H   310                                                      
REMARK 465     ARG H   311                                                      
REMARK 465     ARG H   312                                                      
REMARK 465     LYS H   313                                                      
REMARK 465     GLY H   314                                                      
REMARK 465     SER H   315                                                      
REMARK 465     GLN H   316                                                      
REMARK 465     LYS H   317                                                      
REMARK 465     VAL H   318                                                      
REMARK 465     SER H   319                                                      
REMARK 465     GLY H   320                                                      
REMARK 465     PRO H   321                                                      
REMARK 465     GLN H   322                                                      
REMARK 465     TYR H   323                                                      
REMARK 465     ARG H   324                                                      
REMARK 465     LEU H   325                                                      
REMARK 465     GLU H   326                                                      
REMARK 465     LYS H   327                                                      
REMARK 465     GLN H   328                                                      
REMARK 465     SER H   329                                                      
REMARK 465     GLU H   330                                                      
REMARK 465     PRO H   331                                                      
REMARK 465     ASN H   332                                                      
REMARK 465     VAL H   333                                                      
REMARK 465     ALA H   334                                                      
REMARK 465     VAL H   335                                                      
REMARK 465     ASP H   336                                                      
REMARK 465     LEU H   337                                                      
REMARK 465     ASP H   338                                                      
REMARK 465     SER H   339                                                      
REMARK 465     THR H   340                                                      
REMARK 465     LEU H   341                                                      
REMARK 465     GLU H   342                                                      
REMARK 465     SER H   343                                                      
REMARK 465     GLN H   344                                                      
REMARK 465     SER H   345                                                      
REMARK 465     ALA H   346                                                      
REMARK 465     TRP H   347                                                      
REMARK 465     GLU H   348                                                      
REMARK 465     PHE H   349                                                      
REMARK 465     CYS H   350                                                      
REMARK 465     LEU H   351                                                      
REMARK 465     VAL H   352                                                      
REMARK 465     ARG H   353                                                      
REMARK 465     GLU H   354                                                      
REMARK 465     ASN H   355                                                      
REMARK 465     SER H   356                                                      
REMARK 465     SER H   357                                                      
REMARK 465     ARG H   358                                                      
REMARK 465     ALA H   359                                                      
REMARK 465     ASP H   360                                                      
REMARK 465     GLY H   361                                                      
REMARK 465     VAL H   362                                                      
REMARK 465     PHE H   363                                                      
REMARK 465     GLU H   364                                                      
REMARK 465     GLU H   365                                                      
REMARK 465     ASP H   366                                                      
REMARK 465     SER H   367                                                      
REMARK 465     GLN H   368                                                      
REMARK 465     ILE H   369                                                      
REMARK 465     ASP H   370                                                      
REMARK 465     ILE H   371                                                      
REMARK 465     ALA H   372                                                      
REMARK 465     THR H   373                                                      
REMARK 465     VAL H   374                                                      
REMARK 465     GLN H   375                                                      
REMARK 465     ASP H   376                                                      
REMARK 465     MET H   377                                                      
REMARK 465     LEU H   378                                                      
REMARK 465     SER H   379                                                      
REMARK 465     SER H   380                                                      
REMARK 465     HIS H   381                                                      
REMARK 465     HIS H   382                                                      
REMARK 465     TYR H   383                                                      
REMARK 465     LYS H   384                                                      
REMARK 465     SER H   385                                                      
REMARK 465     PHE H   386                                                      
REMARK 465     LYS H   387                                                      
REMARK 465     VAL H   388                                                      
REMARK 465     SER H   389                                                      
REMARK 465     MET H   390                                                      
REMARK 465     ILE H   391                                                      
REMARK 465     HIS H   392                                                      
REMARK 465     ARG H   393                                                      
REMARK 465     LEU H   394                                                      
REMARK 465     ARG H   395                                                      
REMARK 465     PHE H   396                                                      
REMARK 465     THR H   397                                                      
REMARK 465     THR H   398                                                      
REMARK 465     ASP H   399                                                      
REMARK 465     VAL H   400                                                      
REMARK 465     GLN H   401                                                      
REMARK 465     LEU H   402                                                      
REMARK 465     GLY H   403                                                      
REMARK 465     ILE H   404                                                      
REMARK 465     SER H   405                                                      
REMARK 465     GLY H   406                                                      
REMARK 465     ASP H   407                                                      
REMARK 465     LYS H   408                                                      
REMARK 465     VAL H   409                                                      
REMARK 465     GLU H   410                                                      
REMARK 465     ILE H   411                                                      
REMARK 465     ASP H   412                                                      
REMARK 465     PRO H   413                                                      
REMARK 465     VAL H   414                                                      
REMARK 465     THR H   415                                                      
REMARK 465     ASN H   416                                                      
REMARK 465     GLN H   417                                                      
REMARK 465     LYS H   418                                                      
REMARK 465     ALA H   419                                                      
REMARK 465     SER H   420                                                      
REMARK 465     THR H   421                                                      
REMARK 465     LYS H   422                                                      
REMARK 465     PHE H   423                                                      
REMARK 465     TRP H   424                                                      
REMARK 465     ILE H   425                                                      
REMARK 465     LYS H   426                                                      
REMARK 465     GLN H   427                                                      
REMARK 465     LYS H   428                                                      
REMARK 465     PRO H   429                                                      
REMARK 465     ILE H   430                                                      
REMARK 465     SER H   431                                                      
REMARK 465     ILE H   432                                                      
REMARK 465     ASP H   433                                                      
REMARK 465     SER H   434                                                      
REMARK 465     ASP H   435                                                      
REMARK 465     LEU H   436                                                      
REMARK 465     LEU H   437                                                      
REMARK 465     CYS H   438                                                      
REMARK 465     ALA H   439                                                      
REMARK 465     CYS H   440                                                      
REMARK 465     ASP H   441                                                      
REMARK 465     LEU H   442                                                      
REMARK 465     ALA H   443                                                      
REMARK 465     GLU H   444                                                      
REMARK 465     GLU H   445                                                      
REMARK 465     LYS H   446                                                      
REMARK 465     SER H   447                                                      
REMARK 465     PRO H   448                                                      
REMARK 465     SER H   449                                                      
REMARK 465     HIS H   450                                                      
REMARK 465     ALA H   451                                                      
REMARK 465     ILE H   452                                                      
REMARK 465     PHE H   453                                                      
REMARK 465     LYS H   454                                                      
REMARK 465     LEU H   455                                                      
REMARK 465     THR H   456                                                      
REMARK 465     TYR H   457                                                      
REMARK 465     LEU H   458                                                      
REMARK 465     SER H   459                                                      
REMARK 465     ASN H   460                                                      
REMARK 465     HIS H   461                                                      
REMARK 465     ASP H   462                                                      
REMARK 465     TYR H   463                                                      
REMARK 465     LYS H   464                                                      
REMARK 465     HIS H   465                                                      
REMARK 465     LEU H   466                                                      
REMARK 465     TYR H   467                                                      
REMARK 465     PHE H   468                                                      
REMARK 465     GLU H   469                                                      
REMARK 465     SER H   470                                                      
REMARK 465     ASP H   471                                                      
REMARK 465     ALA H   472                                                      
REMARK 465     ALA H   473                                                      
REMARK 465     THR H   474                                                      
REMARK 465     VAL H   475                                                      
REMARK 465     ASN H   476                                                      
REMARK 465     GLU H   477                                                      
REMARK 465     ILE H   478                                                      
REMARK 465     VAL H   479                                                      
REMARK 465     LEU H   480                                                      
REMARK 465     LYS H   481                                                      
REMARK 465     VAL H   482                                                      
REMARK 465     ASN H   483                                                      
REMARK 465     TYR H   484                                                      
REMARK 465     ILE H   485                                                      
REMARK 465     LEU H   486                                                      
REMARK 465     GLU H   487                                                      
REMARK 465     SER H   488                                                      
REMARK 465     ARG H   489                                                      
REMARK 465     ALA H   490                                                      
REMARK 465     SER H   491                                                      
REMARK 465     THR H   492                                                      
REMARK 465     ALA H   493                                                      
REMARK 465     ARG H   494                                                      
REMARK 465     ALA H   495                                                      
REMARK 465     ASP H   496                                                      
REMARK 465     TYR H   497                                                      
REMARK 465     PHE H   498                                                      
REMARK 465     ALA H   499                                                      
REMARK 465     GLN H   500                                                      
REMARK 465     LYS H   501                                                      
REMARK 465     GLN H   502                                                      
REMARK 465     ARG H   503                                                      
REMARK 465     LYS H   504                                                      
REMARK 465     LEU H   505                                                      
REMARK 465     ASN H   506                                                      
REMARK 465     ARG H   507                                                      
REMARK 465     ARG H   508                                                      
REMARK 465     THR H   509                                                      
REMARK 465     SER H   510                                                      
REMARK 465     PHE H   511                                                      
REMARK 465     SER H   512                                                      
REMARK 465     PHE H   513                                                      
REMARK 465     GLN H   514                                                      
REMARK 465     LYS H   515                                                      
REMARK 465     GLU H   516                                                      
REMARK 465     LYS H   517                                                      
REMARK 465     LYS H   518                                                      
REMARK 465     SER H   519                                                      
REMARK 465     GLY H   520                                                      
REMARK 465     GLN H   521                                                      
REMARK 465     GLN H   522                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     SER A  17    OG                                                  
REMARK 470     ASN A  18    CG   OD1  ND2                                       
REMARK 470     VAL A  19    CG1  CG2                                            
REMARK 470     SER A  20    OG                                                  
REMARK 470     VAL A  21    CG1  CG2                                            
REMARK 470     LEU A  22    CG   CD1  CD2                                       
REMARK 470     GLN A  23    CG   CD   OE1  NE2                                  
REMARK 470     GLN A  24    CG   CD   OE1  NE2                                  
REMARK 470     PHE A  25    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     SER A  27    OG                                                  
REMARK 470     LEU A  29    CG   CD1  CD2                                       
REMARK 470     LYS A  30    CG   CD   CE   NZ                                   
REMARK 470     ARG A  37    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS A  39    CG   CD   CE   NZ                                   
REMARK 470     LYS A  42    CG   CD   CE   NZ                                   
REMARK 470     GLU A  43    CG   CD   OE1  OE2                                  
REMARK 470     LEU A  44    CG   CD1  CD2                                       
REMARK 470     GLN A  45    CG   CD   OE1  NE2                                  
REMARK 470     HIS A  46    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR A  47    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL A  48    CG1  CG2                                            
REMARK 470     THR A  49    OG1  CG2                                            
REMARK 470     MET A  50    CG   SD   CE                                        
REMARK 470     GLU A  51    CG   CD   OE1  OE2                                  
REMARK 470     LEU A  52    CG   CD1  CD2                                       
REMARK 470     ARG A  53    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER A  60    OG                                                  
REMARK 470     LEU A 356    CG   CD1  CD2                                       
REMARK 470     VAL A 357    CG1  CG2                                            
REMARK 470     GLU A 358    CG   CD   OE1  OE2                                  
REMARK 470     SER A 359    OG                                                  
REMARK 470     ARG A 360    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     CYS A 361    SG                                                  
REMARK 470     CYS A 362    SG                                                  
REMARK 470     ARG A 363    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP A 364    CG   OD1  OD2                                       
REMARK 470     LEU A 365    CG   CD1  CD2                                       
REMARK 470     MET A 366    CG   SD   CE                                        
REMARK 470     GLU A 367    CG   CD   OE1  OE2                                  
REMARK 470     GLU A 368    CG   CD   OE1  OE2                                  
REMARK 470     LYS A 369    CG   CD   CE   NZ                                   
REMARK 470     PHE A 370    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP A 371    CG   OD1  OD2                                       
REMARK 470     GLN A 372    CG   CD   OE1  NE2                                  
REMARK 470     VAL A 373    CG1  CG2                                            
REMARK 470     CYS A 374    SG                                                  
REMARK 470     GLN A 375    CG   CD   OE1  NE2                                  
REMARK 470     TRP A 376    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 376    CZ3  CH2                                            
REMARK 470     VAL A 377    CG1  CG2                                            
REMARK 470     LEU A 378    CG   CD1  CD2                                       
REMARK 470     LYS A 379    CG   CD   CE   NZ                                   
REMARK 470     CYS A 380    SG                                                  
REMARK 470     HIS A 549    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASP A 578    CG   OD1  OD2                                       
REMARK 470     GLU A 593    CG   CD   OE1  OE2                                  
REMARK 470     GLU A 812    CG   CD   OE1  OE2                                  
REMARK 470     SER B  17    OG                                                  
REMARK 470     ASN B  18    CG   OD1  ND2                                       
REMARK 470     VAL B  19    CG1  CG2                                            
REMARK 470     SER B  20    OG                                                  
REMARK 470     VAL B  21    CG1  CG2                                            
REMARK 470     LEU B  22    CG   CD1  CD2                                       
REMARK 470     GLN B  23    CG   CD   OE1  NE2                                  
REMARK 470     GLN B  24    CG   CD   OE1  NE2                                  
REMARK 470     PHE B  25    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     SER B  27    OG                                                  
REMARK 470     LEU B  29    CG   CD1  CD2                                       
REMARK 470     LYS B  30    CG   CD   CE   NZ                                   
REMARK 470     ARG B  37    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS B  39    CG   CD   CE   NZ                                   
REMARK 470     LYS B  42    CG   CD   CE   NZ                                   
REMARK 470     GLU B  43    CG   CD   OE1  OE2                                  
REMARK 470     LEU B  44    CG   CD1  CD2                                       
REMARK 470     GLN B  45    CG   CD   OE1  NE2                                  
REMARK 470     HIS B  46    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR B  47    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL B  48    CG1  CG2                                            
REMARK 470     THR B  49    OG1  CG2                                            
REMARK 470     MET B  50    CG   SD   CE                                        
REMARK 470     GLU B  51    CG   CD   OE1  OE2                                  
REMARK 470     LEU B  52    CG   CD1  CD2                                       
REMARK 470     ARG B  53    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER B  60    OG                                                  
REMARK 470     LEU B 356    CG   CD1  CD2                                       
REMARK 470     VAL B 357    CG1  CG2                                            
REMARK 470     GLU B 358    CG   CD   OE1  OE2                                  
REMARK 470     SER B 359    OG                                                  
REMARK 470     ARG B 360    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     CYS B 361    SG                                                  
REMARK 470     CYS B 362    SG                                                  
REMARK 470     ARG B 363    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP B 364    CG   OD1  OD2                                       
REMARK 470     LEU B 365    CG   CD1  CD2                                       
REMARK 470     MET B 366    CG   SD   CE                                        
REMARK 470     GLU B 367    CG   CD   OE1  OE2                                  
REMARK 470     GLU B 368    CG   CD   OE1  OE2                                  
REMARK 470     LYS B 369    CG   CD   CE   NZ                                   
REMARK 470     PHE B 370    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP B 371    CG   OD1  OD2                                       
REMARK 470     GLN B 372    CG   CD   OE1  NE2                                  
REMARK 470     VAL B 373    CG1  CG2                                            
REMARK 470     CYS B 374    SG                                                  
REMARK 470     GLN B 375    CG   CD   OE1  NE2                                  
REMARK 470     TRP B 376    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP B 376    CZ3  CH2                                            
REMARK 470     VAL B 377    CG1  CG2                                            
REMARK 470     LEU B 378    CG   CD1  CD2                                       
REMARK 470     LYS B 379    CG   CD   CE   NZ                                   
REMARK 470     CYS B 380    SG                                                  
REMARK 470     HIS B 549    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASP B 578    CG   OD1  OD2                                       
REMARK 470     GLU B 593    CG   CD   OE1  OE2                                  
REMARK 470     GLU B 812    CG   CD   OE1  OE2                                  
REMARK 470     CYS E 192    SG                                                  
REMARK 470     GLU E 193    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 194    CG   CD1  CD2                                       
REMARK 470     LEU E 196    CG   CD1  CD2                                       
REMARK 470     GLN E 197    CG   CD   OE1  NE2                                  
REMARK 470     ASN E 198    CG   OD1  ND2                                       
REMARK 470     PRO E 199    CG   CD                                             
REMARK 470     GLU E 200    CG   CD   OE1  OE2                                  
REMARK 470     VAL E 201    CG1  CG2                                            
REMARK 470     VAL E 202    CG1  CG2                                            
REMARK 470     LEU E 204    CG   CD1  CD2                                       
REMARK 470     ARG E 205    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 208    CG   CD1  CD2                                       
REMARK 470     ASN E 209    CG   OD1  ND2                                       
REMARK 470     THR E 210    OG1  CG2                                            
REMARK 470     ILE E 211    CG1  CG2  CD1                                       
REMARK 470     LEU E 212    CG   CD1  CD2                                       
REMARK 470     LYS E 213    CG   CD   CE   NZ                                   
REMARK 470     ASN E 214    CG   OD1  ND2                                       
REMARK 470     VAL E 215    CG1  CG2                                            
REMARK 470     ILE E 216    CG1  CG2  CD1                                       
REMARK 470     ASP E 217    CG   OD1  OD2                                       
REMARK 470     CYS E 218    SG                                                  
REMARK 470     GLN E 219    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 220    CG   CD1  CD2                                       
REMARK 470     SER E 221    OG                                                  
REMARK 470     ARG E 222    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE E 223    CG1  CG2  CD1                                       
REMARK 470     ASN E 224    CG   OD1  ND2                                       
REMARK 470     GLU E 225    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 227    CG   CD1  CD2                                       
REMARK 470     ILE E 228    CG1  CG2  CD1                                       
REMARK 470     THR E 229    OG1  CG2                                            
REMARK 470     THR E 230    OG1  CG2                                            
REMARK 470     ILE E 231    CG1  CG2  CD1                                       
REMARK 470     LEU E 232    CG   CD1  CD2                                       
REMARK 470     HIS E 233    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 234    CG   CD1  CD2                                       
REMARK 470     LEU E 235    CG   CD1  CD2                                       
REMARK 470     ASN E 236    CG   OD1  ND2                                       
REMARK 470     HIS E 237    CG   ND1  CD2  CE1  NE2                             
REMARK 470     PRO E 238    CG   CD                                             
REMARK 470     LYS E 239    CG   CD   CE   NZ                                   
REMARK 470     THR E 240    OG1  CG2                                            
REMARK 470     ARG E 241    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN E 242    CG   CD   OE1  NE2                                  
REMARK 470     TYR E 243    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL E 244    CG1  CG2                                            
REMARK 470     ARG E 245    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP E 247    CG   OD1  OD2                                       
REMARK 470     VAL E 248    CG1  CG2                                            
REMARK 470     GLU E 249    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 250    CG   CD1  CD2                                       
REMARK 470     GLU E 251    CG   CD   OE1  OE2                                  
REMARK 470     ARG E 252    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE E 253    CG1  CG2  CD1                                       
REMARK 470     LEU E 254    CG   CD1  CD2                                       
REMARK 470     PRO E 256    CG   CD                                             
REMARK 470     TYR E 257    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     THR E 258    OG1  CG2                                            
REMARK 470     ASP E 259    CG   OD1  OD2                                       
REMARK 470     PHE E 260    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS E 261    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR E 262    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ARG E 263    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     HIS E 264    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER E 265    OG                                                  
REMARK 470     PRO E 266    CG   CD                                             
REMARK 470     ASP E 267    CG   OD1  OD2                                       
REMARK 470     THR E 268    OG1  CG2                                            
REMARK 470     GLU E 270    CG   CD   OE1  OE2                                  
REMARK 470     GLN E 272    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 273    CG   CD1  CD2                                       
REMARK 470     LYS E 274    CG   CD   CE   NZ                                   
REMARK 470     GLU E 275    CG   CD   OE1  OE2                                  
REMARK 470     ASP E 276    CG   OD1  OD2                                       
REMARK 470     ARG E 277    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU E 278    CG   CD   OE1  OE2                                  
REMARK 470     ARG E 280    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE E 281    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 282    CG   CD1  CD2                                       
REMARK 470     SER E 284    OG                                                  
REMARK 470     LYS E 285    CG   CD   CE   NZ                                   
REMARK 470     MET E 286    CG   SD   CE                                        
REMARK 470     ILE E 288    CG1  CG2  CD1                                       
REMARK 470     ILE E 289    CG1  CG2  CD1                                       
REMARK 470     THR E 291    OG1  CG2                                            
REMARK 470     PHE E 292    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG E 293    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER E 294    OG                                                  
REMARK 470     TRP E 295    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 295    CZ3  CH2                                            
REMARK 470     ILE E 298    CG1  CG2  CD1                                       
REMARK 470     ILE E 299    CG1  CG2  CD1                                       
REMARK 470     ASN E 300    CG   OD1  ND2                                       
REMARK 470     LEU E 301    CG   CD1  CD2                                       
REMARK 470     CYS E 302    SG                                                  
REMARK 470     LYS E 303    CG   CD   CE   NZ                                   
REMARK 470     PRO E 304    CG   CD                                             
REMARK 470     ASN E 306    CG   OD1  ND2                                       
REMARK 470     SER E 307    OG                                                  
REMARK 470     ILE E 309    CG1  CG2  CD1                                       
REMARK 470     GLN E 310    CG   CD   OE1  NE2                                  
REMARK 470     SER E 311    OG                                                  
REMARK 470     LEU E 312    CG   CD1  CD2                                       
REMARK 470     ILE E 313    CG1  CG2  CD1                                       
REMARK 470     VAL E 315    CG1  CG2                                            
REMARK 470     LEU E 316    CG   CD1  CD2                                       
REMARK 470     CYS E 317    SG                                                  
REMARK 470     ILE E 318    CG1  CG2  CD1                                       
REMARK 470     PRO E 319    CG   CD                                             
REMARK 470     ASN E 320    CG   OD1  ND2                                       
REMARK 470     MET E 321    CG   SD   CE                                        
REMARK 470     GLU E 322    CG   CD   OE1  OE2                                  
REMARK 470     ILE E 323    CG1  CG2  CD1                                       
REMARK 470     ARG E 324    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG E 325    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 327    CG   CD1  CD2                                       
REMARK 470     LEU E 328    CG   CD1  CD2                                       
REMARK 470     GLU E 329    CG   CD   OE1  OE2                                  
REMARK 470     VAL E 330    CG1  CG2                                            
REMARK 470     LEU E 331    CG   CD1  CD2                                       
REMARK 470     TYR E 332    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASP E 333    CG   OD1  OD2                                       
REMARK 470     ILE E 334    CG1  CG2  CD1                                       
REMARK 470     PHE E 335    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG E 336    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 337    CG   CD1  CD2                                       
REMARK 470     PRO E 338    CG   CD                                             
REMARK 470     LEU E 339    CG   CD1  CD2                                       
REMARK 470     PRO E 340    CG   CD                                             
REMARK 470     VAL E 341    CG1  CG2                                            
REMARK 470     VAL E 342    CG1  CG2                                            
REMARK 470     THR E 343    OG1  CG2                                            
REMARK 470     GLU E 344    CG   CD   OE1  OE2                                  
REMARK 470     GLU E 345    CG   CD   OE1  OE2                                  
REMARK 470     PHE E 346    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE E 347    CG1  CG2  CD1                                       
REMARK 470     GLU E 348    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 350    CG   CD1  CD2                                       
REMARK 470     LEU E 351    CG   CD1  CD2                                       
REMARK 470     SER E 352    OG                                                  
REMARK 470     VAL E 353    CG1  CG2                                            
REMARK 470     ASP E 354    CG   OD1  OD2                                       
REMARK 470     PRO E 355    CG   CD                                             
REMARK 470     ARG E 357    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE E 358    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN E 359    CG   CD   OE1  NE2                                  
REMARK 470     ASP E 360    CG   OD1  OD2                                       
REMARK 470     SER E 361    OG                                                  
REMARK 470     TRP E 362    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 362    CZ3  CH2                                            
REMARK 470     ARG E 363    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 364    CG   CD1  CD2                                       
REMARK 470     SER E 365    OG                                                  
REMARK 470     ASP E 366    CG   OD1  OD2                                       
REMARK 470     PHE E 368    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL E 369    CG1  CG2                                            
REMARK 470     GLU E 372    CG   CD   OE1  OE2                                  
REMARK 470     LYS E 374    CG   CD   CE   NZ                                   
REMARK 470     THR E 375    OG1  CG2                                            
REMARK 470     ILE E 376    CG1  CG2  CD1                                       
REMARK 470     LEU E 377    CG   CD1  CD2                                       
REMARK 470     PRO E 378    CG   CD                                             
REMARK 470     HIS E 379    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG E 380    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG E 382    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER E 383    OG                                                  
REMARK 470     ARG E 384    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO E 385    CG   CD                                             
REMARK 470     ASP E 386    CG   OD1  OD2                                       
REMARK 470     LEU E 387    CG   CD1  CD2                                       
REMARK 470     MET E 388    CG   SD   CE                                        
REMARK 470     ASP E 389    CG   OD1  OD2                                       
REMARK 470     ASN E 390    CG   OD1  ND2                                       
REMARK 470     TYR E 391    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU E 392    CG   CD1  CD2                                       
REMARK 470     LEU E 394    CG   CD1  CD2                                       
REMARK 470     ILE E 395    CG1  CG2  CD1                                       
REMARK 470     LEU E 396    CG   CD1  CD2                                       
REMARK 470     SER E 397    OG                                                  
REMARK 470     PHE E 399    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE E 400    CG1  CG2  CD1                                       
REMARK 470     ARG E 401    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN E 402    CG   OD1  ND2                                       
REMARK 470     LEU E 404    CG   CD1  CD2                                       
REMARK 470     LEU E 405    CG   CD1  CD2                                       
REMARK 470     GLU E 406    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 408    CG   CD1  CD2                                       
REMARK 470     VAL E 409    CG1  CG2                                            
REMARK 470     GLU E 410    CG   CD   OE1  OE2                                  
REMARK 470     VAL E 411    CG1  CG2                                            
REMARK 470     ILE E 412    CG1  CG2  CD1                                       
REMARK 470     THR E 413    OG1  CG2                                            
REMARK 470     ASN E 414    CG   OD1  ND2                                       
REMARK 470     SER E 415    OG                                                  
REMARK 470     ASP E 416    CG   OD1  OD2                                       
REMARK 470     ASP E 417    CG   OD1  OD2                                       
REMARK 470     HIS E 418    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ILE E 419    CG1  CG2  CD1                                       
REMARK 470     SER E 420    OG                                                  
REMARK 470     VAL E 421    CG1  CG2                                            
REMARK 470     ARG E 422    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR E 424    OG1  CG2                                            
REMARK 470     ILE E 425    CG1  CG2  CD1                                       
REMARK 470     LEU E 426    CG   CD1  CD2                                       
REMARK 470     LEU E 427    CG   CD1  CD2                                       
REMARK 470     GLU E 429    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 430    CG   CD1  CD2                                       
REMARK 470     LEU E 431    CG   CD1  CD2                                       
REMARK 470     HIS E 432    CG   ND1  CD2  CE1  NE2                             
REMARK 470     MET E 433    CG   SD   CE                                        
REMARK 470     ASN E 435    CG   OD1  ND2                                       
REMARK 470     THR E 436    OG1  CG2                                            
REMARK 470     ILE E 437    CG1  CG2  CD1                                       
REMARK 470     LEU E 438    CG   CD1  CD2                                       
REMARK 470     PRO E 439    CG   CD                                             
REMARK 470     HIS E 440    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER E 441    OG                                                  
REMARK 470     HIS E 442    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER E 443    OG                                                  
REMARK 470     HIS E 444    CG   ND1  CD2  CE1  NE2                             
REMARK 470     HIS E 445    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 446    CG   CD1  CD2                                       
REMARK 470     HIS E 447    CG   ND1  CD2  CE1  NE2                             
REMARK 470     CYS E 448    SG                                                  
REMARK 470     LEU E 449    CG   CD1  CD2                                       
REMARK 470     PRO E 450    CG   CD                                             
REMARK 470     THR E 451    OG1  CG2                                            
REMARK 470     LEU E 452    CG   CD1  CD2                                       
REMARK 470     MET E 453    CG   SD   CE                                        
REMARK 470     ASN E 454    CG   OD1  ND2                                       
REMARK 470     MET E 455    CG   SD   CE                                        
REMARK 470     SER E 458    OG                                                  
REMARK 470     PHE E 459    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP E 460    CG   OD1  OD2                                       
REMARK 470     ILE E 461    CG1  CG2  CD1                                       
REMARK 470     PRO E 462    CG   CD                                             
REMARK 470     LYS E 463    CG   CD   CE   NZ                                   
REMARK 470     GLU E 464    CG   CD   OE1  OE2                                  
REMARK 470     LYS E 465    CG   CD   CE   NZ                                   
REMARK 470     ARG E 466    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 467    CG   CD1  CD2                                       
REMARK 470     ARG E 468    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER E 470    OG                                                  
REMARK 470     LEU E 473    CG   CD1  CD2                                       
REMARK 470     ASN E 474    CG   OD1  ND2                                       
REMARK 470     CYS E 475    SG                                                  
REMARK 470     LEU E 476    CG   CD1  CD2                                       
REMARK 470     LYS E 477    CG   CD   CE   NZ                                   
REMARK 470     ARG E 478    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE E 479    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS E 480    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLU E 481    CG   CD   OE1  OE2                                  
REMARK 470     MET E 482    CG   SD   CE                                        
REMARK 470     LYS E 483    CG   CD   CE   NZ                                   
REMARK 470     LYS E 484    CG   CD   CE   NZ                                   
REMARK 470     ARG E 485    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO E 487    CG   CD                                             
REMARK 470     LYS E 488    CG   CD   CE   NZ                                   
REMARK 470     PRO E 489    CG   CD                                             
REMARK 470     TYR E 490    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER E 491    OG                                                  
REMARK 470     LEU E 492    CG   CD1  CD2                                       
REMARK 470     HIS E 493    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 494    CG   CD1  CD2                                       
REMARK 470     ASP E 495    CG   OD1  OD2                                       
REMARK 470     HIS E 496    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ILE E 497    CG1  CG2  CD1                                       
REMARK 470     ILE E 498    CG1  CG2  CD1                                       
REMARK 470     GLN E 499    CG   CD   OE1  NE2                                  
REMARK 470     LYS E 500    CG   CD   CE   NZ                                   
REMARK 470     ILE E 502    CG1  CG2  CD1                                       
REMARK 470     THR E 504    OG1  CG2                                            
REMARK 470     HIS E 505    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN E 506    CG   CD   OE1  NE2                                  
REMARK 470     LYS E 507    CG   CD   CE   NZ                                   
REMARK 470     ARG E 508    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP E 509    CG   OD1  OD2                                       
REMARK 470     GLN E 510    CG   CD   OE1  NE2                                  
REMARK 470     TYR E 511    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU E 512    CG   CD1  CD2                                       
REMARK 470     ARG E 513    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL E 514    CG1  CG2                                            
REMARK 470     GLN E 515    CG   CD   OE1  NE2                                  
REMARK 470     LYS E 516    CG   CD   CE   NZ                                   
REMARK 470     ASP E 517    CG   OD1  OD2                                       
REMARK 470     ILE E 518    CG1  CG2  CD1                                       
REMARK 470     PHE E 519    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE E 520    CG1  CG2  CD1                                       
REMARK 470     LEU E 521    CG   CD1  CD2                                       
REMARK 470     LYS E 522    CG   CD   CE   NZ                                   
REMARK 470     ASP E 523    CG   OD1  OD2                                       
REMARK 470     THR E 524    OG1  CG2                                            
REMARK 470     GLU E 525    CG   CD   OE1  OE2                                  
REMARK 470     GLU E 526    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 528    CG   CD1  CD2                                       
REMARK 470     LEU E 529    CG   CD1  CD2                                       
REMARK 470     ILE E 530    CG1  CG2  CD1                                       
REMARK 470     ASN E 531    CG   OD1  ND2                                       
REMARK 470     LEU E 532    CG   CD1  CD2                                       
REMARK 470     ARG E 533    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP E 534    CG   OD1  OD2                                       
REMARK 470     SER E 535    OG                                                  
REMARK 470     GLN E 536    CG   CD   OE1  NE2                                  
REMARK 470     VAL E 537    CG1  CG2                                            
REMARK 470     LEU E 538    CG   CD1  CD2                                       
REMARK 470     GLN E 539    CG   CD   OE1  NE2                                  
REMARK 470     HIS E 540    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS E 541    CG   CD   CE   NZ                                   
REMARK 470     GLU E 542    CG   CD   OE1  OE2                                  
REMARK 470     ASN E 543    CG   OD1  ND2                                       
REMARK 470     LEU E 544    CG   CD1  CD2                                       
REMARK 470     GLU E 545    CG   CD   OE1  OE2                                  
REMARK 470     TRP E 546    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 546    CZ3  CH2                                            
REMARK 470     ASN E 547    CG   OD1  ND2                                       
REMARK 470     TRP E 548    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 548    CZ3  CH2                                            
REMARK 470     ASN E 549    CG   OD1  ND2                                       
REMARK 470     LEU E 550    CG   CD1  CD2                                       
REMARK 470     ILE E 551    CG1  CG2  CD1                                       
REMARK 470     THR E 553    OG1  CG2                                            
REMARK 470     ILE E 554    CG1  CG2  CD1                                       
REMARK 470     LEU E 555    CG   CD1  CD2                                       
REMARK 470     LYS E 556    CG   CD   CE   NZ                                   
REMARK 470     TRP E 557    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 557    CZ3  CH2                                            
REMARK 470     PRO E 558    CG   CD                                             
REMARK 470     ASN E 559    CG   OD1  ND2                                       
REMARK 470     VAL E 560    CG1  CG2                                            
REMARK 470     ASN E 561    CG   OD1  ND2                                       
REMARK 470     LEU E 562    CG   CD1  CD2                                       
REMARK 470     ARG E 563    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN E 564    CG   OD1  ND2                                       
REMARK 470     TYR E 565    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LYS E 566    CG   CD   CE   NZ                                   
REMARK 470     ASP E 567    CG   OD1  OD2                                       
REMARK 470     GLU E 568    CG   CD   OE1  OE2                                  
REMARK 470     GLN E 569    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 570    CG   CD1  CD2                                       
REMARK 470     HIS E 571    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG E 572    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE E 573    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL E 574    CG1  CG2                                            
REMARK 470     ARG E 575    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG E 576    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 577    CG   CD1  CD2                                       
REMARK 470     LEU E 578    CG   CD1  CD2                                       
REMARK 470     TYR E 579    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE E 580    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     TYR E 581    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LYS E 582    CG   CD   CE   NZ                                   
REMARK 470     PRO E 583    CG   CD                                             
REMARK 470     SER E 584    OG                                                  
REMARK 470     SER E 585    OG                                                  
REMARK 470     LYS E 586    CG   CD   CE   NZ                                   
REMARK 470     LEU E 587    CG   CD1  CD2                                       
REMARK 470     TYR E 588    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASN E 590    CG   OD1  ND2                                       
REMARK 470     LEU E 591    CG   CD1  CD2                                       
REMARK 470     ASP E 592    CG   OD1  OD2                                       
REMARK 470     LEU E 593    CG   CD1  CD2                                       
REMARK 470     ASP E 594    CG   OD1  OD2                                       
REMARK 470     PHE E 595    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS E 597    CG   CD   CE   NZ                                   
REMARK 470     LYS E 599    CG   CD   CE   NZ                                   
REMARK 470     GLN E 600    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 601    CG   CD1  CD2                                       
REMARK 470     THR E 602    OG1  CG2                                            
REMARK 470     VAL E 603    CG1  CG2                                            
REMARK 470     VAL E 604    CG1  CG2                                            
REMARK 470     CYS E 606    SG                                                  
REMARK 470     GLN E 607    CG   CD   OE1  NE2                                  
REMARK 470     PHE E 608    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR E 609    OG1  CG2                                            
REMARK 470     GLU E 610    CG   CD   OE1  OE2                                  
REMARK 470     PHE E 611    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 612    CG   CD1  CD2                                       
REMARK 470     LEU E 613    CG   CD1  CD2                                       
REMARK 470     GLU E 614    CG   CD   OE1  OE2                                  
REMARK 470     SER E 615    OG                                                  
REMARK 470     GLU E 616    CG   CD   OE1  OE2                                  
REMARK 470     GLU E 617    CG   CD   OE1  OE2                                  
REMARK 470     ASP E 618    CG   OD1  OD2                                       
REMARK 470     GLN E 620    CG   CD   OE1  NE2                                  
REMARK 470     TYR E 622    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU E 623    CG   CD1  CD2                                       
REMARK 470     GLU E 624    CG   CD   OE1  OE2                                  
REMARK 470     ASP E 625    CG   OD1  OD2                                       
REMARK 470     LEU E 626    CG   CD1  CD2                                       
REMARK 470     VAL E 627    CG1  CG2                                            
REMARK 470     LYS E 628    CG   CD   CE   NZ                                   
REMARK 470     ASP E 629    CG   OD1  OD2                                       
REMARK 470     ILE E 630    CG1  CG2  CD1                                       
REMARK 470     VAL E 631    CG1  CG2                                            
REMARK 470     GLN E 632    CG   CD   OE1  NE2                                  
REMARK 470     TRP E 633    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 633    CZ3  CH2                                            
REMARK 470     LEU E 634    CG   CD1  CD2                                       
REMARK 470     ASN E 635    CG   OD1  ND2                                       
REMARK 470     SER E 637    OG                                                  
REMARK 470     SER E 638    OG                                                  
REMARK 470     MET E 640    CG   SD   CE                                        
REMARK 470     LYS E 641    CG   CD   CE   NZ                                   
REMARK 470     PRO E 642    CG   CD                                             
REMARK 470     GLU E 643    CG   CD   OE1  OE2                                  
REMARK 470     ARG E 644    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER E 645    OG                                                  
REMARK 470     LEU E 646    CG   CD1  CD2                                       
REMARK 470     GLN E 647    CG   CD   OE1  NE2                                  
REMARK 470     ASN E 648    CG   OD1  ND2                                       
REMARK 470     ASN E 649    CG   OD1  ND2                                       
REMARK 470     LEU E 651    CG   CD1  CD2                                       
REMARK 470     LEU E 652    CG   CD1  CD2                                       
REMARK 470     THR E 653    OG1  CG2                                            
REMARK 470     THR E 654    OG1  CG2                                            
REMARK 470     LEU E 655    CG   CD1  CD2                                       
REMARK 470     SER E 656    OG                                                  
REMARK 470     GLN E 657    CG   CD   OE1  NE2                                  
REMARK 470     HIS E 658    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR E 659    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE E 660    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 661    CG   CD1  CD2                                       
REMARK 470     PHE E 662    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE E 663    CG1  CG2  CD1                                       
REMARK 470     THR E 665    OG1  CG2                                            
REMARK 470     LEU E 666    CG   CD1  CD2                                       
REMARK 470     SER E 667    OG                                                  
REMARK 470     CYS E 668    SG                                                  
REMARK 470     HIS E 669    CG   ND1  CD2  CE1  NE2                             
REMARK 470     PRO E 670    CG   CD                                             
REMARK 470     HIS E 671    CG   ND1  CD2  CE1  NE2                             
REMARK 470     VAL E 673    CG1  CG2                                            
REMARK 470     LYS E 674    CG   CD   CE   NZ                                   
REMARK 470     MET E 675    CG   SD   CE                                        
REMARK 470     LEU E 676    CG   CD1  CD2                                       
REMARK 470     GLU E 677    CG   CD   OE1  OE2                                  
REMARK 470     LYS E 678    CG   CD   CE   NZ                                   
REMARK 470     CYS E 679    SG                                                  
REMARK 470     SER E 680    OG                                                  
REMARK 470     VAL E 681    CG1  CG2                                            
REMARK 470     PHE E 682    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN E 683    CG   CD   OE1  NE2                                  
REMARK 470     CYS E 684    SG                                                  
REMARK 470     LEU E 685    CG   CD1  CD2                                       
REMARK 470     LEU E 686    CG   CD1  CD2                                       
REMARK 470     ASN E 687    CG   OD1  ND2                                       
REMARK 470     LEU E 688    CG   CD1  CD2                                       
REMARK 470     CYS E 689    SG                                                  
REMARK 470     SER E 690    OG                                                  
REMARK 470     LEU E 691    CG   CD1  CD2                                       
REMARK 470     LYS E 692    CG   CD   CE   NZ                                   
REMARK 470     ASN E 693    CG   OD1  ND2                                       
REMARK 470     GLN E 694    CG   CD   OE1  NE2                                  
REMARK 470     ASP E 695    CG   OD1  OD2                                       
REMARK 470     HIS E 696    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 697    CG   CD1  CD2                                       
REMARK 470     LEU E 698    CG   CD1  CD2                                       
REMARK 470     LYS E 699    CG   CD   CE   NZ                                   
REMARK 470     LEU E 700    CG   CD1  CD2                                       
REMARK 470     THR E 701    OG1  CG2                                            
REMARK 470     VAL E 702    CG1  CG2                                            
REMARK 470     SER E 703    OG                                                  
REMARK 470     SER E 704    OG                                                  
REMARK 470     LEU E 705    CG   CD1  CD2                                       
REMARK 470     ASP E 706    CG   OD1  OD2                                       
REMARK 470     TYR E 707    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER E 708    OG                                                  
REMARK 470     ARG E 709    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP E 710    CG   OD1  OD2                                       
REMARK 470     LEU E 712    CG   CD1  CD2                                       
REMARK 470     ARG E 714    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL E 715    CG1  CG2                                            
REMARK 470     ILE E 716    CG1  CG2  CD1                                       
REMARK 470     LEU E 717    CG   CD1  CD2                                       
REMARK 470     SER E 718    OG                                                  
REMARK 470     LYS E 719    CG   CD   CE   NZ                                   
REMARK 470     ILE E 720    CG1  CG2  CD1                                       
REMARK 470     LEU E 721    CG   CD1  CD2                                       
REMARK 470     THR E 722    OG1  CG2                                            
REMARK 470     THR E 725    OG1  CG2                                            
REMARK 470     ASP E 726    CG   OD1  OD2                                       
REMARK 470     CYS E 728    SG                                                  
REMARK 470     ARG E 729    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 730    CG   CD1  CD2                                       
REMARK 470     TYR E 731    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     THR E 733    OG1  CG2                                            
REMARK 470     LYS E 734    CG   CD   CE   NZ                                   
REMARK 470     HIS E 735    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 736    CG   CD1  CD2                                       
REMARK 470     ARG E 737    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL E 738    CG1  CG2                                            
REMARK 470     LEU E 739    CG   CD1  CD2                                       
REMARK 470     LEU E 740    CG   CD1  CD2                                       
REMARK 470     ARG E 741    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN E 743    CG   OD1  ND2                                       
REMARK 470     VAL E 744    CG1  CG2                                            
REMARK 470     GLU E 745    CG   CD   OE1  OE2                                  
REMARK 470     PHE E 746    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     PHE E 747    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASN E 748    CG   OD1  ND2                                       
REMARK 470     ASN E 749    CG   OD1  ND2                                       
REMARK 470     TRP E 750    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 750    CZ3  CH2                                            
REMARK 470     ILE E 752    CG1  CG2  CD1                                       
REMARK 470     GLU E 753    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 754    CG   CD1  CD2                                       
REMARK 470     LEU E 755    CG   CD1  CD2                                       
REMARK 470     VAL E 756    CG1  CG2                                            
REMARK 470     THR E 757    OG1  CG2                                            
REMARK 470     GLN E 758    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 759    CG   CD1  CD2                                       
REMARK 470     HIS E 760    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASP E 761    CG   OD1  OD2                                       
REMARK 470     LYS E 762    CG   CD   CE   NZ                                   
REMARK 470     ASN E 763    CG   OD1  ND2                                       
REMARK 470     LYS E 764    CG   CD   CE   NZ                                   
REMARK 470     THR E 765    OG1  CG2                                            
REMARK 470     ILE E 766    CG1  CG2  CD1                                       
REMARK 470     SER E 767    OG                                                  
REMARK 470     SER E 768    OG                                                  
REMARK 470     GLU E 769    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 771    CG   CD1  CD2                                       
REMARK 470     ASP E 772    CG   OD1  OD2                                       
REMARK 470     ILE E 773    CG1  CG2  CD1                                       
REMARK 470     LEU E 774    CG   CD1  CD2                                       
REMARK 470     ASP E 775    CG   OD1  OD2                                       
REMARK 470     GLU E 776    CG   CD   OE1  OE2                                  
REMARK 470     CYS E 778    SG                                                  
REMARK 470     GLU E 779    CG   CD   OE1  OE2                                  
REMARK 470     ASP E 780    CG   OD1  OD2                                       
REMARK 470     LYS E 781    CG   CD   CE   NZ                                   
REMARK 470     ASN E 783    CG   OD1  ND2                                       
REMARK 470     LEU E 784    CG   CD1  CD2                                       
REMARK 470     HIS E 785    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 787    CG   CD1  CD2                                       
REMARK 470     ILE E 788    CG1  CG2  CD1                                       
REMARK 470     GLN E 789    CG   CD   OE1  NE2                                  
REMARK 470     MET E 790    CG   SD   CE                                        
REMARK 470     LYS E 791    CG   CD   CE   NZ                                   
REMARK 470     PRO E 792    CG   CD                                             
REMARK 470     LEU E 794    CG   CD1  CD2                                       
REMARK 470     SER E 795    OG                                                  
REMARK 470     HIS E 796    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 797    CG   CD1  CD2                                       
REMARK 470     ASP E 799    CG   OD1  OD2                                       
REMARK 470     LYS E 800    CG   CD   CE   NZ                                   
REMARK 470     LEU E 802    CG   CD1  CD2                                       
REMARK 470     LEU E 803    CG   CD1  CD2                                       
REMARK 470     LEU E 804    CG   CD1  CD2                                       
REMARK 470     LEU E 805    CG   CD1  CD2                                       
REMARK 470     LEU E 806    CG   CD1  CD2                                       
REMARK 470     ARG E 807    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE E 808    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 809    CG   CD1  CD2                                       
REMARK 470     SER E 810    OG                                                  
REMARK 470     ILE E 811    CG1  CG2  CD1                                       
REMARK 470     PRO E 812    CG   CD                                             
REMARK 470     LYS E 813    CG   CD   CE   NZ                                   
REMARK 470     PHE E 815    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     SER E 816    OG                                                  
REMARK 470     TYR E 817    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU E 818    CG   CD1  CD2                                       
REMARK 470     ASN E 819    CG   OD1  ND2                                       
REMARK 470     GLU E 820    CG   CD   OE1  OE2                                  
REMARK 470     ARG E 821    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     TYR E 823    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL E 824    CG1  CG2                                            
REMARK 470     LYS E 826    CG   CD   CE   NZ                                   
REMARK 470     GLN E 827    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 828    CG   CD1  CD2                                       
REMARK 470     GLU E 829    CG   CD   OE1  OE2                                  
REMARK 470     LYS E 830    CG   CD   CE   NZ                                   
REMARK 470     TRP E 831    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 831    CZ3  CH2                                            
REMARK 470     HIS E 832    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG E 833    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU E 834    CG   CD   OE1  OE2                                  
REMARK 470     TYR E 835    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASN E 836    CG   OD1  ND2                                       
REMARK 470     SER E 837    OG                                                  
REMARK 470     LYS E 838    CG   CD   CE   NZ                                   
REMARK 470     TYR E 839    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL E 840    CG1  CG2                                            
REMARK 470     ASP E 841    CG   OD1  OD2                                       
REMARK 470     LEU E 842    CG   CD1  CD2                                       
REMARK 470     ILE E 843    CG1  CG2  CD1                                       
REMARK 470     GLU E 844    CG   CD   OE1  OE2                                  
REMARK 470     GLU E 845    CG   CD   OE1  OE2                                  
REMARK 470     GLN E 846    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 847    CG   CD1  CD2                                       
REMARK 470     ASN E 848    CG   OD1  ND2                                       
REMARK 470     GLU E 849    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 851    CG   CD1  CD2                                       
REMARK 470     THR E 852    OG1  CG2                                            
REMARK 470     THR E 853    OG1  CG2                                            
REMARK 470     TYR E 854    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ARG E 855    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS E 856    CG   CD   CE   NZ                                   
REMARK 470     PRO E 857    CG   CD                                             
REMARK 470     VAL E 858    CG1  CG2                                            
REMARK 470     ASP E 859    CG   OD1  OD2                                       
REMARK 470     ASP E 861    CG   OD1  OD2                                       
REMARK 470     ASN E 862    CG   OD1  ND2                                       
REMARK 470     TYR E 863    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL E 864    CG1  CG2                                            
REMARK 470     ARG E 865    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG E 866    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER E 867    OG                                                  
REMARK 470     ASN E 868    CG   OD1  ND2                                       
REMARK 470     GLN E 869    CG   CD   OE1  NE2                                  
REMARK 470     ARG E 870    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU E 871    CG   CD1  CD2                                       
REMARK 470     GLN E 872    CG   CD   OE1  NE2                                  
REMARK 470     ARG E 873    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO E 874    CG   CD                                             
REMARK 470     HIS E 875    CG   ND1  CD2  CE1  NE2                             
REMARK 470     VAL E 876    CG1  CG2                                            
REMARK 470     TYR E 877    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU E 878    CG   CD1  CD2                                       
REMARK 470     PRO E 879    CG   CD                                             
REMARK 470     ILE E 880    CG1  CG2  CD1                                       
REMARK 470     HIS E 881    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 882    CG   CD1  CD2                                       
REMARK 470     TYR E 883    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN E 885    CG   CD   OE1  NE2                                  
REMARK 470     LEU E 886    CG   CD1  CD2                                       
REMARK 470     VAL E 887    CG1  CG2                                            
REMARK 470     HIS E 888    CG   ND1  CD2  CE1  NE2                             
REMARK 470     HIS E 889    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS E 890    CG   CD   CE   NZ                                   
REMARK 470     THR E 891    OG1  CG2                                            
REMARK 470     CYS E 893    SG                                                  
REMARK 470     HIS E 894    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E 895    CG   CD1  CD2                                       
REMARK 470     LEU E 896    CG   CD1  CD2                                       
REMARK 470     GLU E 897    CG   CD   OE1  OE2                                  
REMARK 470     VAL E 898    CG1  CG2                                            
REMARK 470     GLN E 899    CG   CD   OE1  NE2                                  
REMARK 470     ASN E 900    CG   OD1  ND2                                       
REMARK 470     ILE E 901    CG1  CG2  CD1                                       
REMARK 470     ILE E 902    CG1  CG2  CD1                                       
REMARK 470     THR E 903    OG1  CG2                                            
REMARK 470     GLU E 904    CG   CD   OE1  OE2                                  
REMARK 470     LEU E 905    CG   CD1  CD2                                       
REMARK 470     CYS E 906    SG                                                  
REMARK 470     ARG E 907    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN E 908    CG   OD1  ND2                                       
REMARK 470     VAL E 909    CG1  CG2                                            
REMARK 470     ARG E 910    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR E 911    OG1  CG2                                            
REMARK 470     PRO E 912    CG   CD                                             
REMARK 470     ASP E 913    CG   OD1  OD2                                       
REMARK 470     LEU E 914    CG   CD1  CD2                                       
REMARK 470     ASP E 915    CG   OD1  OD2                                       
REMARK 470     LYS E 916    CG   CD   CE   NZ                                   
REMARK 470     TRP E 917    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 917    CZ3  CH2                                            
REMARK 470     GLU E 918    CG   CD   OE1  OE2                                  
REMARK 470     GLU E 919    CG   CD   OE1  OE2                                  
REMARK 470     ILE E 920    CG1  CG2  CD1                                       
REMARK 470     LYS E 921    CG   CD   CE   NZ                                   
REMARK 470     LYS E 922    CG   CD   CE   NZ                                   
REMARK 470     LEU E 923    CG   CD1  CD2                                       
REMARK 470     LYS E 924    CG   CD   CE   NZ                                   
REMARK 470     SER E 926    OG                                                  
REMARK 470     LEU E 927    CG   CD1  CD2                                       
REMARK 470     TRP E 928    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 928    CZ3  CH2                                            
REMARK 470     LEU E 930    CG   CD1  CD2                                       
REMARK 470     ASN E 932    CG   OD1  ND2                                       
REMARK 470     ILE E 933    CG1  CG2  CD1                                       
REMARK 470     SER E 935    OG                                                  
REMARK 470     SER E 936    OG                                                  
REMARK 470     ASN E 937    CG   OD1  ND2                                       
REMARK 470     TRP E 938    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 938    CZ3  CH2                                            
REMARK 470     LEU E 940    CG   CD1  CD2                                       
REMARK 470     ASN E 941    CG   OD1  ND2                                       
REMARK 470     LEU E 942    CG   CD1  CD2                                       
REMARK 470     LEU E 943    CG   CD1  CD2                                       
REMARK 470     GLN E 944    CG   CD   OE1  NE2                                  
REMARK 470     GLU E 945    CG   CD   OE1  OE2                                  
REMARK 470     GLU E 946    CG   CD   OE1  OE2                                  
REMARK 470     ASN E 947    CG   OD1  ND2                                       
REMARK 470     VAL E 948    CG1  CG2                                            
REMARK 470     ILE E 949    CG1  CG2  CD1                                       
REMARK 470     PRO E 950    CG   CD                                             
REMARK 470     ASP E 951    CG   OD1  OD2                                       
REMARK 470     ILE E 952    CG1  CG2  CD1                                       
REMARK 470     LEU E 953    CG   CD1  CD2                                       
REMARK 470     LYS E 954    CG   CD   CE   NZ                                   
REMARK 470     LEU E 955    CG   CD1  CD2                                       
REMARK 470     LYS E 957    CG   CD   CE   NZ                                   
REMARK 470     GLN E 958    CG   CD   OE1  NE2                                  
REMARK 470     CYS E 959    SG                                                  
REMARK 470     GLU E 960    CG   CD   OE1  OE2                                  
REMARK 470     VAL E 961    CG1  CG2                                            
REMARK 470     LEU E 962    CG   CD1  CD2                                       
REMARK 470     SER E 963    OG                                                  
REMARK 470     ILE E 964    CG1  CG2  CD1                                       
REMARK 470     ARG E 965    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR E 967    OG1  CG2                                            
REMARK 470     CYS E 968    SG                                                  
REMARK 470     VAL E 969    CG1  CG2                                            
REMARK 470     TYR E 970    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL E 971    CG1  CG2                                            
REMARK 470     LEU E 972    CG   CD1  CD2                                       
REMARK 470     LEU E 974    CG   CD1  CD2                                       
REMARK 470     ILE E 975    CG1  CG2  CD1                                       
REMARK 470     LYS E 977    CG   CD   CE   NZ                                   
REMARK 470     THR E 978    OG1  CG2                                            
REMARK 470     LYS E 979    CG   CD   CE   NZ                                   
REMARK 470     GLN E 980    CG   CD   OE1  NE2                                  
REMARK 470     CYS E 982    SG                                                  
REMARK 470     ASP E 983    CG   OD1  OD2                                       
REMARK 470     ILE E 984    CG1  CG2  CD1                                       
REMARK 470     LEU E 985    CG   CD1  CD2                                       
REMARK 470     LYS E 986    CG   CD   CE   NZ                                   
REMARK 470     CYS E 987    SG                                                  
REMARK 470     HIS E 988    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASN E 989    CG   OD1  ND2                                       
REMARK 470     TRP E 990    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E 990    CZ3  CH2                                            
REMARK 470     ASP E 991    CG   OD1  OD2                                       
REMARK 470     VAL E 993    CG1  CG2                                            
REMARK 470     ARG E 994    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     HIS E 995    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER E 996    OG                                                  
REMARK 470     ARG E 997    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS E 998    CG   CD   CE   NZ                                   
REMARK 470     HIS E 999    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU E1000    CG   CD1  CD2                                       
REMARK 470     TRP E1001    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP E1001    CZ3  CH2                                            
REMARK 470     PRO E1002    CG   CD                                             
REMARK 470     VAL E1003    CG1  CG2                                            
REMARK 470     VAL E1004    CG1  CG2                                            
REMARK 470     PRO E1005    CG   CD                                             
REMARK 470     ASP E1006    CG   OD1  OD2                                       
REMARK 470     ASP E1007    CG   OD1  OD2                                       
REMARK 470     VAL E1008    CG1  CG2                                            
REMARK 470     GLU E1009    CG   CD   OE1  OE2                                  
REMARK 470     GLN E1010    CG   CD   OE1  NE2                                  
REMARK 470     LEU E1011    CG   CD1  CD2                                       
REMARK 470     CYS E1012    SG                                                  
REMARK 470     ASN E1013    CG   OD1  ND2                                       
REMARK 470     GLU E1014    CG   CD   OE1  OE2                                  
REMARK 470     LEU E1015    CG   CD1  CD2                                       
REMARK 470     SER E1016    OG                                                  
REMARK 470     SER E1017    OG                                                  
REMARK 470     ILE E1018    CG1  CG2  CD1                                       
REMARK 470     CYS F 192    SG                                                  
REMARK 470     GLU F 193    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 194    CG   CD1  CD2                                       
REMARK 470     LEU F 196    CG   CD1  CD2                                       
REMARK 470     GLN F 197    CG   CD   OE1  NE2                                  
REMARK 470     ASN F 198    CG   OD1  ND2                                       
REMARK 470     PRO F 199    CG   CD                                             
REMARK 470     GLU F 200    CG   CD   OE1  OE2                                  
REMARK 470     VAL F 201    CG1  CG2                                            
REMARK 470     VAL F 202    CG1  CG2                                            
REMARK 470     LEU F 204    CG   CD1  CD2                                       
REMARK 470     ARG F 205    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 208    CG   CD1  CD2                                       
REMARK 470     ASN F 209    CG   OD1  ND2                                       
REMARK 470     THR F 210    OG1  CG2                                            
REMARK 470     ILE F 211    CG1  CG2  CD1                                       
REMARK 470     LEU F 212    CG   CD1  CD2                                       
REMARK 470     LYS F 213    CG   CD   CE   NZ                                   
REMARK 470     ASN F 214    CG   OD1  ND2                                       
REMARK 470     VAL F 215    CG1  CG2                                            
REMARK 470     ILE F 216    CG1  CG2  CD1                                       
REMARK 470     ASP F 217    CG   OD1  OD2                                       
REMARK 470     CYS F 218    SG                                                  
REMARK 470     GLN F 219    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 220    CG   CD1  CD2                                       
REMARK 470     SER F 221    OG                                                  
REMARK 470     ARG F 222    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE F 223    CG1  CG2  CD1                                       
REMARK 470     ASN F 224    CG   OD1  ND2                                       
REMARK 470     GLU F 225    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 227    CG   CD1  CD2                                       
REMARK 470     ILE F 228    CG1  CG2  CD1                                       
REMARK 470     THR F 229    OG1  CG2                                            
REMARK 470     THR F 230    OG1  CG2                                            
REMARK 470     ILE F 231    CG1  CG2  CD1                                       
REMARK 470     LEU F 232    CG   CD1  CD2                                       
REMARK 470     HIS F 233    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 234    CG   CD1  CD2                                       
REMARK 470     LEU F 235    CG   CD1  CD2                                       
REMARK 470     ASN F 236    CG   OD1  ND2                                       
REMARK 470     HIS F 237    CG   ND1  CD2  CE1  NE2                             
REMARK 470     PRO F 238    CG   CD                                             
REMARK 470     LYS F 239    CG   CD   CE   NZ                                   
REMARK 470     THR F 240    OG1  CG2                                            
REMARK 470     ARG F 241    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN F 242    CG   CD   OE1  NE2                                  
REMARK 470     TYR F 243    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL F 244    CG1  CG2                                            
REMARK 470     ARG F 245    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP F 247    CG   OD1  OD2                                       
REMARK 470     VAL F 248    CG1  CG2                                            
REMARK 470     GLU F 249    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 250    CG   CD1  CD2                                       
REMARK 470     GLU F 251    CG   CD   OE1  OE2                                  
REMARK 470     ARG F 252    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE F 253    CG1  CG2  CD1                                       
REMARK 470     LEU F 254    CG   CD1  CD2                                       
REMARK 470     PRO F 256    CG   CD                                             
REMARK 470     TYR F 257    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     THR F 258    OG1  CG2                                            
REMARK 470     ASP F 259    CG   OD1  OD2                                       
REMARK 470     PHE F 260    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS F 261    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR F 262    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ARG F 263    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     HIS F 264    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER F 265    OG                                                  
REMARK 470     PRO F 266    CG   CD                                             
REMARK 470     ASP F 267    CG   OD1  OD2                                       
REMARK 470     THR F 268    OG1  CG2                                            
REMARK 470     GLU F 270    CG   CD   OE1  OE2                                  
REMARK 470     GLN F 272    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 273    CG   CD1  CD2                                       
REMARK 470     LYS F 274    CG   CD   CE   NZ                                   
REMARK 470     GLU F 275    CG   CD   OE1  OE2                                  
REMARK 470     ASP F 276    CG   OD1  OD2                                       
REMARK 470     ARG F 277    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU F 278    CG   CD   OE1  OE2                                  
REMARK 470     ARG F 280    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE F 281    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU F 282    CG   CD1  CD2                                       
REMARK 470     SER F 284    OG                                                  
REMARK 470     LYS F 285    CG   CD   CE   NZ                                   
REMARK 470     MET F 286    CG   SD   CE                                        
REMARK 470     ILE F 288    CG1  CG2  CD1                                       
REMARK 470     ILE F 289    CG1  CG2  CD1                                       
REMARK 470     THR F 291    OG1  CG2                                            
REMARK 470     PHE F 292    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG F 293    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER F 294    OG                                                  
REMARK 470     TRP F 295    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 295    CZ3  CH2                                            
REMARK 470     ILE F 298    CG1  CG2  CD1                                       
REMARK 470     ILE F 299    CG1  CG2  CD1                                       
REMARK 470     ASN F 300    CG   OD1  ND2                                       
REMARK 470     LEU F 301    CG   CD1  CD2                                       
REMARK 470     CYS F 302    SG                                                  
REMARK 470     LYS F 303    CG   CD   CE   NZ                                   
REMARK 470     PRO F 304    CG   CD                                             
REMARK 470     ASN F 306    CG   OD1  ND2                                       
REMARK 470     SER F 307    OG                                                  
REMARK 470     ILE F 309    CG1  CG2  CD1                                       
REMARK 470     GLN F 310    CG   CD   OE1  NE2                                  
REMARK 470     SER F 311    OG                                                  
REMARK 470     LEU F 312    CG   CD1  CD2                                       
REMARK 470     ILE F 313    CG1  CG2  CD1                                       
REMARK 470     VAL F 315    CG1  CG2                                            
REMARK 470     LEU F 316    CG   CD1  CD2                                       
REMARK 470     CYS F 317    SG                                                  
REMARK 470     ILE F 318    CG1  CG2  CD1                                       
REMARK 470     PRO F 319    CG   CD                                             
REMARK 470     ASN F 320    CG   OD1  ND2                                       
REMARK 470     MET F 321    CG   SD   CE                                        
REMARK 470     GLU F 322    CG   CD   OE1  OE2                                  
REMARK 470     ILE F 323    CG1  CG2  CD1                                       
REMARK 470     ARG F 324    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG F 325    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 327    CG   CD1  CD2                                       
REMARK 470     LEU F 328    CG   CD1  CD2                                       
REMARK 470     GLU F 329    CG   CD   OE1  OE2                                  
REMARK 470     VAL F 330    CG1  CG2                                            
REMARK 470     LEU F 331    CG   CD1  CD2                                       
REMARK 470     TYR F 332    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASP F 333    CG   OD1  OD2                                       
REMARK 470     ILE F 334    CG1  CG2  CD1                                       
REMARK 470     PHE F 335    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG F 336    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 337    CG   CD1  CD2                                       
REMARK 470     PRO F 338    CG   CD                                             
REMARK 470     LEU F 339    CG   CD1  CD2                                       
REMARK 470     PRO F 340    CG   CD                                             
REMARK 470     VAL F 341    CG1  CG2                                            
REMARK 470     VAL F 342    CG1  CG2                                            
REMARK 470     THR F 343    OG1  CG2                                            
REMARK 470     GLU F 344    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 345    CG   CD   OE1  OE2                                  
REMARK 470     PHE F 346    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE F 347    CG1  CG2  CD1                                       
REMARK 470     GLU F 348    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 350    CG   CD1  CD2                                       
REMARK 470     LEU F 351    CG   CD1  CD2                                       
REMARK 470     SER F 352    OG                                                  
REMARK 470     VAL F 353    CG1  CG2                                            
REMARK 470     ASP F 354    CG   OD1  OD2                                       
REMARK 470     PRO F 355    CG   CD                                             
REMARK 470     ARG F 357    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE F 358    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN F 359    CG   CD   OE1  NE2                                  
REMARK 470     ASP F 360    CG   OD1  OD2                                       
REMARK 470     SER F 361    OG                                                  
REMARK 470     TRP F 362    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 362    CZ3  CH2                                            
REMARK 470     ARG F 363    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 364    CG   CD1  CD2                                       
REMARK 470     SER F 365    OG                                                  
REMARK 470     ASP F 366    CG   OD1  OD2                                       
REMARK 470     PHE F 368    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL F 369    CG1  CG2                                            
REMARK 470     GLU F 372    CG   CD   OE1  OE2                                  
REMARK 470     LYS F 374    CG   CD   CE   NZ                                   
REMARK 470     THR F 375    OG1  CG2                                            
REMARK 470     ILE F 376    CG1  CG2  CD1                                       
REMARK 470     LEU F 377    CG   CD1  CD2                                       
REMARK 470     PRO F 378    CG   CD                                             
REMARK 470     HIS F 379    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG F 380    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG F 382    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER F 383    OG                                                  
REMARK 470     ARG F 384    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO F 385    CG   CD                                             
REMARK 470     ASP F 386    CG   OD1  OD2                                       
REMARK 470     LEU F 387    CG   CD1  CD2                                       
REMARK 470     MET F 388    CG   SD   CE                                        
REMARK 470     ASP F 389    CG   OD1  OD2                                       
REMARK 470     ASN F 390    CG   OD1  ND2                                       
REMARK 470     TYR F 391    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU F 392    CG   CD1  CD2                                       
REMARK 470     LEU F 394    CG   CD1  CD2                                       
REMARK 470     ILE F 395    CG1  CG2  CD1                                       
REMARK 470     LEU F 396    CG   CD1  CD2                                       
REMARK 470     SER F 397    OG                                                  
REMARK 470     PHE F 399    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE F 400    CG1  CG2  CD1                                       
REMARK 470     ARG F 401    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN F 402    CG   OD1  ND2                                       
REMARK 470     LEU F 404    CG   CD1  CD2                                       
REMARK 470     LEU F 405    CG   CD1  CD2                                       
REMARK 470     GLU F 406    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 408    CG   CD1  CD2                                       
REMARK 470     VAL F 409    CG1  CG2                                            
REMARK 470     GLU F 410    CG   CD   OE1  OE2                                  
REMARK 470     VAL F 411    CG1  CG2                                            
REMARK 470     ILE F 412    CG1  CG2  CD1                                       
REMARK 470     THR F 413    OG1  CG2                                            
REMARK 470     ASN F 414    CG   OD1  ND2                                       
REMARK 470     SER F 415    OG                                                  
REMARK 470     ASP F 416    CG   OD1  OD2                                       
REMARK 470     ASP F 417    CG   OD1  OD2                                       
REMARK 470     HIS F 418    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ILE F 419    CG1  CG2  CD1                                       
REMARK 470     SER F 420    OG                                                  
REMARK 470     VAL F 421    CG1  CG2                                            
REMARK 470     ARG F 422    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR F 424    OG1  CG2                                            
REMARK 470     ILE F 425    CG1  CG2  CD1                                       
REMARK 470     LEU F 426    CG   CD1  CD2                                       
REMARK 470     LEU F 427    CG   CD1  CD2                                       
REMARK 470     GLU F 429    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 430    CG   CD1  CD2                                       
REMARK 470     LEU F 431    CG   CD1  CD2                                       
REMARK 470     HIS F 432    CG   ND1  CD2  CE1  NE2                             
REMARK 470     MET F 433    CG   SD   CE                                        
REMARK 470     ASN F 435    CG   OD1  ND2                                       
REMARK 470     THR F 436    OG1  CG2                                            
REMARK 470     ILE F 437    CG1  CG2  CD1                                       
REMARK 470     LEU F 438    CG   CD1  CD2                                       
REMARK 470     PRO F 439    CG   CD                                             
REMARK 470     HIS F 440    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER F 441    OG                                                  
REMARK 470     HIS F 442    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER F 443    OG                                                  
REMARK 470     HIS F 444    CG   ND1  CD2  CE1  NE2                             
REMARK 470     HIS F 445    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 446    CG   CD1  CD2                                       
REMARK 470     HIS F 447    CG   ND1  CD2  CE1  NE2                             
REMARK 470     CYS F 448    SG                                                  
REMARK 470     LEU F 449    CG   CD1  CD2                                       
REMARK 470     PRO F 450    CG   CD                                             
REMARK 470     THR F 451    OG1  CG2                                            
REMARK 470     LEU F 452    CG   CD1  CD2                                       
REMARK 470     MET F 453    CG   SD   CE                                        
REMARK 470     ASN F 454    CG   OD1  ND2                                       
REMARK 470     MET F 455    CG   SD   CE                                        
REMARK 470     SER F 458    OG                                                  
REMARK 470     PHE F 459    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASP F 460    CG   OD1  OD2                                       
REMARK 470     ILE F 461    CG1  CG2  CD1                                       
REMARK 470     PRO F 462    CG   CD                                             
REMARK 470     LYS F 463    CG   CD   CE   NZ                                   
REMARK 470     GLU F 464    CG   CD   OE1  OE2                                  
REMARK 470     LYS F 465    CG   CD   CE   NZ                                   
REMARK 470     ARG F 466    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 467    CG   CD1  CD2                                       
REMARK 470     ARG F 468    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER F 470    OG                                                  
REMARK 470     LEU F 473    CG   CD1  CD2                                       
REMARK 470     ASN F 474    CG   OD1  ND2                                       
REMARK 470     CYS F 475    SG                                                  
REMARK 470     LEU F 476    CG   CD1  CD2                                       
REMARK 470     LYS F 477    CG   CD   CE   NZ                                   
REMARK 470     ARG F 478    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE F 479    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS F 480    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLU F 481    CG   CD   OE1  OE2                                  
REMARK 470     MET F 482    CG   SD   CE                                        
REMARK 470     LYS F 483    CG   CD   CE   NZ                                   
REMARK 470     LYS F 484    CG   CD   CE   NZ                                   
REMARK 470     ARG F 485    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO F 487    CG   CD                                             
REMARK 470     LYS F 488    CG   CD   CE   NZ                                   
REMARK 470     PRO F 489    CG   CD                                             
REMARK 470     TYR F 490    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER F 491    OG                                                  
REMARK 470     LEU F 492    CG   CD1  CD2                                       
REMARK 470     HIS F 493    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 494    CG   CD1  CD2                                       
REMARK 470     ASP F 495    CG   OD1  OD2                                       
REMARK 470     HIS F 496    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ILE F 497    CG1  CG2  CD1                                       
REMARK 470     ILE F 498    CG1  CG2  CD1                                       
REMARK 470     GLN F 499    CG   CD   OE1  NE2                                  
REMARK 470     LYS F 500    CG   CD   CE   NZ                                   
REMARK 470     ILE F 502    CG1  CG2  CD1                                       
REMARK 470     THR F 504    OG1  CG2                                            
REMARK 470     HIS F 505    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN F 506    CG   CD   OE1  NE2                                  
REMARK 470     LYS F 507    CG   CD   CE   NZ                                   
REMARK 470     ARG F 508    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP F 509    CG   OD1  OD2                                       
REMARK 470     GLN F 510    CG   CD   OE1  NE2                                  
REMARK 470     TYR F 511    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU F 512    CG   CD1  CD2                                       
REMARK 470     ARG F 513    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL F 514    CG1  CG2                                            
REMARK 470     GLN F 515    CG   CD   OE1  NE2                                  
REMARK 470     LYS F 516    CG   CD   CE   NZ                                   
REMARK 470     ASP F 517    CG   OD1  OD2                                       
REMARK 470     ILE F 518    CG1  CG2  CD1                                       
REMARK 470     PHE F 519    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE F 520    CG1  CG2  CD1                                       
REMARK 470     LEU F 521    CG   CD1  CD2                                       
REMARK 470     LYS F 522    CG   CD   CE   NZ                                   
REMARK 470     ASP F 523    CG   OD1  OD2                                       
REMARK 470     THR F 524    OG1  CG2                                            
REMARK 470     GLU F 525    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 526    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 528    CG   CD1  CD2                                       
REMARK 470     LEU F 529    CG   CD1  CD2                                       
REMARK 470     ILE F 530    CG1  CG2  CD1                                       
REMARK 470     ASN F 531    CG   OD1  ND2                                       
REMARK 470     LEU F 532    CG   CD1  CD2                                       
REMARK 470     ARG F 533    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP F 534    CG   OD1  OD2                                       
REMARK 470     SER F 535    OG                                                  
REMARK 470     GLN F 536    CG   CD   OE1  NE2                                  
REMARK 470     VAL F 537    CG1  CG2                                            
REMARK 470     LEU F 538    CG   CD1  CD2                                       
REMARK 470     GLN F 539    CG   CD   OE1  NE2                                  
REMARK 470     HIS F 540    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS F 541    CG   CD   CE   NZ                                   
REMARK 470     GLU F 542    CG   CD   OE1  OE2                                  
REMARK 470     ASN F 543    CG   OD1  ND2                                       
REMARK 470     LEU F 544    CG   CD1  CD2                                       
REMARK 470     GLU F 545    CG   CD   OE1  OE2                                  
REMARK 470     TRP F 546    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 546    CZ3  CH2                                            
REMARK 470     ASN F 547    CG   OD1  ND2                                       
REMARK 470     TRP F 548    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 548    CZ3  CH2                                            
REMARK 470     ASN F 549    CG   OD1  ND2                                       
REMARK 470     LEU F 550    CG   CD1  CD2                                       
REMARK 470     ILE F 551    CG1  CG2  CD1                                       
REMARK 470     THR F 553    OG1  CG2                                            
REMARK 470     ILE F 554    CG1  CG2  CD1                                       
REMARK 470     LEU F 555    CG   CD1  CD2                                       
REMARK 470     LYS F 556    CG   CD   CE   NZ                                   
REMARK 470     TRP F 557    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 557    CZ3  CH2                                            
REMARK 470     PRO F 558    CG   CD                                             
REMARK 470     ASN F 559    CG   OD1  ND2                                       
REMARK 470     VAL F 560    CG1  CG2                                            
REMARK 470     ASN F 561    CG   OD1  ND2                                       
REMARK 470     LEU F 562    CG   CD1  CD2                                       
REMARK 470     ARG F 563    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN F 564    CG   OD1  ND2                                       
REMARK 470     TYR F 565    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LYS F 566    CG   CD   CE   NZ                                   
REMARK 470     ASP F 567    CG   OD1  OD2                                       
REMARK 470     GLU F 568    CG   CD   OE1  OE2                                  
REMARK 470     GLN F 569    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 570    CG   CD1  CD2                                       
REMARK 470     HIS F 571    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG F 572    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE F 573    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     VAL F 574    CG1  CG2                                            
REMARK 470     ARG F 575    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG F 576    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 577    CG   CD1  CD2                                       
REMARK 470     LEU F 578    CG   CD1  CD2                                       
REMARK 470     TYR F 579    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE F 580    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     TYR F 581    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LYS F 582    CG   CD   CE   NZ                                   
REMARK 470     PRO F 583    CG   CD                                             
REMARK 470     SER F 584    OG                                                  
REMARK 470     SER F 585    OG                                                  
REMARK 470     LYS F 586    CG   CD   CE   NZ                                   
REMARK 470     LEU F 587    CG   CD1  CD2                                       
REMARK 470     TYR F 588    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASN F 590    CG   OD1  ND2                                       
REMARK 470     LEU F 591    CG   CD1  CD2                                       
REMARK 470     ASP F 592    CG   OD1  OD2                                       
REMARK 470     LEU F 593    CG   CD1  CD2                                       
REMARK 470     ASP F 594    CG   OD1  OD2                                       
REMARK 470     PHE F 595    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS F 597    CG   CD   CE   NZ                                   
REMARK 470     LYS F 599    CG   CD   CE   NZ                                   
REMARK 470     GLN F 600    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 601    CG   CD1  CD2                                       
REMARK 470     THR F 602    OG1  CG2                                            
REMARK 470     VAL F 603    CG1  CG2                                            
REMARK 470     VAL F 604    CG1  CG2                                            
REMARK 470     CYS F 606    SG                                                  
REMARK 470     GLN F 607    CG   CD   OE1  NE2                                  
REMARK 470     PHE F 608    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     THR F 609    OG1  CG2                                            
REMARK 470     GLU F 610    CG   CD   OE1  OE2                                  
REMARK 470     PHE F 611    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU F 612    CG   CD1  CD2                                       
REMARK 470     LEU F 613    CG   CD1  CD2                                       
REMARK 470     GLU F 614    CG   CD   OE1  OE2                                  
REMARK 470     SER F 615    OG                                                  
REMARK 470     GLU F 616    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 617    CG   CD   OE1  OE2                                  
REMARK 470     ASP F 618    CG   OD1  OD2                                       
REMARK 470     GLN F 620    CG   CD   OE1  NE2                                  
REMARK 470     TYR F 622    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU F 623    CG   CD1  CD2                                       
REMARK 470     GLU F 624    CG   CD   OE1  OE2                                  
REMARK 470     ASP F 625    CG   OD1  OD2                                       
REMARK 470     LEU F 626    CG   CD1  CD2                                       
REMARK 470     VAL F 627    CG1  CG2                                            
REMARK 470     LYS F 628    CG   CD   CE   NZ                                   
REMARK 470     ASP F 629    CG   OD1  OD2                                       
REMARK 470     ILE F 630    CG1  CG2  CD1                                       
REMARK 470     VAL F 631    CG1  CG2                                            
REMARK 470     GLN F 632    CG   CD   OE1  NE2                                  
REMARK 470     TRP F 633    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 633    CZ3  CH2                                            
REMARK 470     LEU F 634    CG   CD1  CD2                                       
REMARK 470     ASN F 635    CG   OD1  ND2                                       
REMARK 470     SER F 637    OG                                                  
REMARK 470     SER F 638    OG                                                  
REMARK 470     MET F 640    CG   SD   CE                                        
REMARK 470     LYS F 641    CG   CD   CE   NZ                                   
REMARK 470     PRO F 642    CG   CD                                             
REMARK 470     GLU F 643    CG   CD   OE1  OE2                                  
REMARK 470     ARG F 644    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER F 645    OG                                                  
REMARK 470     LEU F 646    CG   CD1  CD2                                       
REMARK 470     GLN F 647    CG   CD   OE1  NE2                                  
REMARK 470     ASN F 648    CG   OD1  ND2                                       
REMARK 470     ASN F 649    CG   OD1  ND2                                       
REMARK 470     LEU F 651    CG   CD1  CD2                                       
REMARK 470     LEU F 652    CG   CD1  CD2                                       
REMARK 470     THR F 653    OG1  CG2                                            
REMARK 470     THR F 654    OG1  CG2                                            
REMARK 470     LEU F 655    CG   CD1  CD2                                       
REMARK 470     SER F 656    OG                                                  
REMARK 470     GLN F 657    CG   CD   OE1  NE2                                  
REMARK 470     HIS F 658    CG   ND1  CD2  CE1  NE2                             
REMARK 470     TYR F 659    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     PHE F 660    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU F 661    CG   CD1  CD2                                       
REMARK 470     PHE F 662    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE F 663    CG1  CG2  CD1                                       
REMARK 470     THR F 665    OG1  CG2                                            
REMARK 470     LEU F 666    CG   CD1  CD2                                       
REMARK 470     SER F 667    OG                                                  
REMARK 470     CYS F 668    SG                                                  
REMARK 470     HIS F 669    CG   ND1  CD2  CE1  NE2                             
REMARK 470     PRO F 670    CG   CD                                             
REMARK 470     HIS F 671    CG   ND1  CD2  CE1  NE2                             
REMARK 470     VAL F 673    CG1  CG2                                            
REMARK 470     LYS F 674    CG   CD   CE   NZ                                   
REMARK 470     MET F 675    CG   SD   CE                                        
REMARK 470     LEU F 676    CG   CD1  CD2                                       
REMARK 470     GLU F 677    CG   CD   OE1  OE2                                  
REMARK 470     LYS F 678    CG   CD   CE   NZ                                   
REMARK 470     CYS F 679    SG                                                  
REMARK 470     SER F 680    OG                                                  
REMARK 470     VAL F 681    CG1  CG2                                            
REMARK 470     PHE F 682    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     GLN F 683    CG   CD   OE1  NE2                                  
REMARK 470     CYS F 684    SG                                                  
REMARK 470     LEU F 685    CG   CD1  CD2                                       
REMARK 470     LEU F 686    CG   CD1  CD2                                       
REMARK 470     ASN F 687    CG   OD1  ND2                                       
REMARK 470     LEU F 688    CG   CD1  CD2                                       
REMARK 470     CYS F 689    SG                                                  
REMARK 470     SER F 690    OG                                                  
REMARK 470     LEU F 691    CG   CD1  CD2                                       
REMARK 470     LYS F 692    CG   CD   CE   NZ                                   
REMARK 470     ASN F 693    CG   OD1  ND2                                       
REMARK 470     GLN F 694    CG   CD   OE1  NE2                                  
REMARK 470     ASP F 695    CG   OD1  OD2                                       
REMARK 470     HIS F 696    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 697    CG   CD1  CD2                                       
REMARK 470     LEU F 698    CG   CD1  CD2                                       
REMARK 470     LYS F 699    CG   CD   CE   NZ                                   
REMARK 470     LEU F 700    CG   CD1  CD2                                       
REMARK 470     THR F 701    OG1  CG2                                            
REMARK 470     VAL F 702    CG1  CG2                                            
REMARK 470     SER F 703    OG                                                  
REMARK 470     SER F 704    OG                                                  
REMARK 470     LEU F 705    CG   CD1  CD2                                       
REMARK 470     ASP F 706    CG   OD1  OD2                                       
REMARK 470     TYR F 707    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     SER F 708    OG                                                  
REMARK 470     ARG F 709    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP F 710    CG   OD1  OD2                                       
REMARK 470     LEU F 712    CG   CD1  CD2                                       
REMARK 470     ARG F 714    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL F 715    CG1  CG2                                            
REMARK 470     ILE F 716    CG1  CG2  CD1                                       
REMARK 470     LEU F 717    CG   CD1  CD2                                       
REMARK 470     SER F 718    OG                                                  
REMARK 470     LYS F 719    CG   CD   CE   NZ                                   
REMARK 470     ILE F 720    CG1  CG2  CD1                                       
REMARK 470     LEU F 721    CG   CD1  CD2                                       
REMARK 470     THR F 722    OG1  CG2                                            
REMARK 470     THR F 725    OG1  CG2                                            
REMARK 470     ASP F 726    CG   OD1  OD2                                       
REMARK 470     CYS F 728    SG                                                  
REMARK 470     ARG F 729    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 730    CG   CD1  CD2                                       
REMARK 470     TYR F 731    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     THR F 733    OG1  CG2                                            
REMARK 470     LYS F 734    CG   CD   CE   NZ                                   
REMARK 470     HIS F 735    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 736    CG   CD1  CD2                                       
REMARK 470     ARG F 737    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     VAL F 738    CG1  CG2                                            
REMARK 470     LEU F 739    CG   CD1  CD2                                       
REMARK 470     LEU F 740    CG   CD1  CD2                                       
REMARK 470     ARG F 741    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN F 743    CG   OD1  ND2                                       
REMARK 470     VAL F 744    CG1  CG2                                            
REMARK 470     GLU F 745    CG   CD   OE1  OE2                                  
REMARK 470     PHE F 746    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     PHE F 747    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASN F 748    CG   OD1  ND2                                       
REMARK 470     ASN F 749    CG   OD1  ND2                                       
REMARK 470     TRP F 750    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 750    CZ3  CH2                                            
REMARK 470     ILE F 752    CG1  CG2  CD1                                       
REMARK 470     GLU F 753    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 754    CG   CD1  CD2                                       
REMARK 470     LEU F 755    CG   CD1  CD2                                       
REMARK 470     VAL F 756    CG1  CG2                                            
REMARK 470     THR F 757    OG1  CG2                                            
REMARK 470     GLN F 758    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 759    CG   CD1  CD2                                       
REMARK 470     HIS F 760    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASP F 761    CG   OD1  OD2                                       
REMARK 470     LYS F 762    CG   CD   CE   NZ                                   
REMARK 470     ASN F 763    CG   OD1  ND2                                       
REMARK 470     LYS F 764    CG   CD   CE   NZ                                   
REMARK 470     THR F 765    OG1  CG2                                            
REMARK 470     ILE F 766    CG1  CG2  CD1                                       
REMARK 470     SER F 767    OG                                                  
REMARK 470     SER F 768    OG                                                  
REMARK 470     GLU F 769    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 771    CG   CD1  CD2                                       
REMARK 470     ASP F 772    CG   OD1  OD2                                       
REMARK 470     ILE F 773    CG1  CG2  CD1                                       
REMARK 470     LEU F 774    CG   CD1  CD2                                       
REMARK 470     ASP F 775    CG   OD1  OD2                                       
REMARK 470     GLU F 776    CG   CD   OE1  OE2                                  
REMARK 470     CYS F 778    SG                                                  
REMARK 470     GLU F 779    CG   CD   OE1  OE2                                  
REMARK 470     ASP F 780    CG   OD1  OD2                                       
REMARK 470     LYS F 781    CG   CD   CE   NZ                                   
REMARK 470     ASN F 783    CG   OD1  ND2                                       
REMARK 470     LEU F 784    CG   CD1  CD2                                       
REMARK 470     HIS F 785    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 787    CG   CD1  CD2                                       
REMARK 470     ILE F 788    CG1  CG2  CD1                                       
REMARK 470     GLN F 789    CG   CD   OE1  NE2                                  
REMARK 470     MET F 790    CG   SD   CE                                        
REMARK 470     LYS F 791    CG   CD   CE   NZ                                   
REMARK 470     PRO F 792    CG   CD                                             
REMARK 470     LEU F 794    CG   CD1  CD2                                       
REMARK 470     SER F 795    OG                                                  
REMARK 470     HIS F 796    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 797    CG   CD1  CD2                                       
REMARK 470     ASP F 799    CG   OD1  OD2                                       
REMARK 470     LYS F 800    CG   CD   CE   NZ                                   
REMARK 470     LEU F 802    CG   CD1  CD2                                       
REMARK 470     LEU F 803    CG   CD1  CD2                                       
REMARK 470     LEU F 804    CG   CD1  CD2                                       
REMARK 470     LEU F 805    CG   CD1  CD2                                       
REMARK 470     LEU F 806    CG   CD1  CD2                                       
REMARK 470     ARG F 807    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE F 808    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU F 809    CG   CD1  CD2                                       
REMARK 470     SER F 810    OG                                                  
REMARK 470     ILE F 811    CG1  CG2  CD1                                       
REMARK 470     PRO F 812    CG   CD                                             
REMARK 470     LYS F 813    CG   CD   CE   NZ                                   
REMARK 470     PHE F 815    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     SER F 816    OG                                                  
REMARK 470     TYR F 817    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU F 818    CG   CD1  CD2                                       
REMARK 470     ASN F 819    CG   OD1  ND2                                       
REMARK 470     GLU F 820    CG   CD   OE1  OE2                                  
REMARK 470     ARG F 821    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     TYR F 823    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL F 824    CG1  CG2                                            
REMARK 470     LYS F 826    CG   CD   CE   NZ                                   
REMARK 470     GLN F 827    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 828    CG   CD1  CD2                                       
REMARK 470     GLU F 829    CG   CD   OE1  OE2                                  
REMARK 470     LYS F 830    CG   CD   CE   NZ                                   
REMARK 470     TRP F 831    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 831    CZ3  CH2                                            
REMARK 470     HIS F 832    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG F 833    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU F 834    CG   CD   OE1  OE2                                  
REMARK 470     TYR F 835    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ASN F 836    CG   OD1  ND2                                       
REMARK 470     SER F 837    OG                                                  
REMARK 470     LYS F 838    CG   CD   CE   NZ                                   
REMARK 470     TYR F 839    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL F 840    CG1  CG2                                            
REMARK 470     ASP F 841    CG   OD1  OD2                                       
REMARK 470     LEU F 842    CG   CD1  CD2                                       
REMARK 470     ILE F 843    CG1  CG2  CD1                                       
REMARK 470     GLU F 844    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 845    CG   CD   OE1  OE2                                  
REMARK 470     GLN F 846    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 847    CG   CD1  CD2                                       
REMARK 470     ASN F 848    CG   OD1  ND2                                       
REMARK 470     GLU F 849    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 851    CG   CD1  CD2                                       
REMARK 470     THR F 852    OG1  CG2                                            
REMARK 470     THR F 853    OG1  CG2                                            
REMARK 470     TYR F 854    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     ARG F 855    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS F 856    CG   CD   CE   NZ                                   
REMARK 470     PRO F 857    CG   CD                                             
REMARK 470     VAL F 858    CG1  CG2                                            
REMARK 470     ASP F 859    CG   OD1  OD2                                       
REMARK 470     ASP F 861    CG   OD1  OD2                                       
REMARK 470     ASN F 862    CG   OD1  ND2                                       
REMARK 470     TYR F 863    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL F 864    CG1  CG2                                            
REMARK 470     ARG F 865    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG F 866    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER F 867    OG                                                  
REMARK 470     ASN F 868    CG   OD1  ND2                                       
REMARK 470     GLN F 869    CG   CD   OE1  NE2                                  
REMARK 470     ARG F 870    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU F 871    CG   CD1  CD2                                       
REMARK 470     GLN F 872    CG   CD   OE1  NE2                                  
REMARK 470     ARG F 873    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PRO F 874    CG   CD                                             
REMARK 470     HIS F 875    CG   ND1  CD2  CE1  NE2                             
REMARK 470     VAL F 876    CG1  CG2                                            
REMARK 470     TYR F 877    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU F 878    CG   CD1  CD2                                       
REMARK 470     PRO F 879    CG   CD                                             
REMARK 470     ILE F 880    CG1  CG2  CD1                                       
REMARK 470     HIS F 881    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 882    CG   CD1  CD2                                       
REMARK 470     TYR F 883    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN F 885    CG   CD   OE1  NE2                                  
REMARK 470     LEU F 886    CG   CD1  CD2                                       
REMARK 470     VAL F 887    CG1  CG2                                            
REMARK 470     HIS F 888    CG   ND1  CD2  CE1  NE2                             
REMARK 470     HIS F 889    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS F 890    CG   CD   CE   NZ                                   
REMARK 470     THR F 891    OG1  CG2                                            
REMARK 470     CYS F 893    SG                                                  
REMARK 470     HIS F 894    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F 895    CG   CD1  CD2                                       
REMARK 470     LEU F 896    CG   CD1  CD2                                       
REMARK 470     GLU F 897    CG   CD   OE1  OE2                                  
REMARK 470     VAL F 898    CG1  CG2                                            
REMARK 470     GLN F 899    CG   CD   OE1  NE2                                  
REMARK 470     ASN F 900    CG   OD1  ND2                                       
REMARK 470     ILE F 901    CG1  CG2  CD1                                       
REMARK 470     ILE F 902    CG1  CG2  CD1                                       
REMARK 470     THR F 903    OG1  CG2                                            
REMARK 470     GLU F 904    CG   CD   OE1  OE2                                  
REMARK 470     LEU F 905    CG   CD1  CD2                                       
REMARK 470     CYS F 906    SG                                                  
REMARK 470     ARG F 907    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN F 908    CG   OD1  ND2                                       
REMARK 470     VAL F 909    CG1  CG2                                            
REMARK 470     ARG F 910    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR F 911    OG1  CG2                                            
REMARK 470     PRO F 912    CG   CD                                             
REMARK 470     ASP F 913    CG   OD1  OD2                                       
REMARK 470     LEU F 914    CG   CD1  CD2                                       
REMARK 470     ASP F 915    CG   OD1  OD2                                       
REMARK 470     LYS F 916    CG   CD   CE   NZ                                   
REMARK 470     TRP F 917    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 917    CZ3  CH2                                            
REMARK 470     GLU F 918    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 919    CG   CD   OE1  OE2                                  
REMARK 470     ILE F 920    CG1  CG2  CD1                                       
REMARK 470     LYS F 921    CG   CD   CE   NZ                                   
REMARK 470     LYS F 922    CG   CD   CE   NZ                                   
REMARK 470     LEU F 923    CG   CD1  CD2                                       
REMARK 470     LYS F 924    CG   CD   CE   NZ                                   
REMARK 470     SER F 926    OG                                                  
REMARK 470     LEU F 927    CG   CD1  CD2                                       
REMARK 470     TRP F 928    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 928    CZ3  CH2                                            
REMARK 470     LEU F 930    CG   CD1  CD2                                       
REMARK 470     ASN F 932    CG   OD1  ND2                                       
REMARK 470     ILE F 933    CG1  CG2  CD1                                       
REMARK 470     SER F 935    OG                                                  
REMARK 470     SER F 936    OG                                                  
REMARK 470     ASN F 937    CG   OD1  ND2                                       
REMARK 470     TRP F 938    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 938    CZ3  CH2                                            
REMARK 470     LEU F 940    CG   CD1  CD2                                       
REMARK 470     ASN F 941    CG   OD1  ND2                                       
REMARK 470     LEU F 942    CG   CD1  CD2                                       
REMARK 470     LEU F 943    CG   CD1  CD2                                       
REMARK 470     GLN F 944    CG   CD   OE1  NE2                                  
REMARK 470     GLU F 945    CG   CD   OE1  OE2                                  
REMARK 470     GLU F 946    CG   CD   OE1  OE2                                  
REMARK 470     ASN F 947    CG   OD1  ND2                                       
REMARK 470     VAL F 948    CG1  CG2                                            
REMARK 470     ILE F 949    CG1  CG2  CD1                                       
REMARK 470     PRO F 950    CG   CD                                             
REMARK 470     ASP F 951    CG   OD1  OD2                                       
REMARK 470     ILE F 952    CG1  CG2  CD1                                       
REMARK 470     LEU F 953    CG   CD1  CD2                                       
REMARK 470     LYS F 954    CG   CD   CE   NZ                                   
REMARK 470     LEU F 955    CG   CD1  CD2                                       
REMARK 470     LYS F 957    CG   CD   CE   NZ                                   
REMARK 470     GLN F 958    CG   CD   OE1  NE2                                  
REMARK 470     CYS F 959    SG                                                  
REMARK 470     GLU F 960    CG   CD   OE1  OE2                                  
REMARK 470     VAL F 961    CG1  CG2                                            
REMARK 470     LEU F 962    CG   CD1  CD2                                       
REMARK 470     SER F 963    OG                                                  
REMARK 470     ILE F 964    CG1  CG2  CD1                                       
REMARK 470     ARG F 965    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR F 967    OG1  CG2                                            
REMARK 470     CYS F 968    SG                                                  
REMARK 470     VAL F 969    CG1  CG2                                            
REMARK 470     TYR F 970    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     VAL F 971    CG1  CG2                                            
REMARK 470     LEU F 972    CG   CD1  CD2                                       
REMARK 470     LEU F 974    CG   CD1  CD2                                       
REMARK 470     ILE F 975    CG1  CG2  CD1                                       
REMARK 470     LYS F 977    CG   CD   CE   NZ                                   
REMARK 470     THR F 978    OG1  CG2                                            
REMARK 470     LYS F 979    CG   CD   CE   NZ                                   
REMARK 470     GLN F 980    CG   CD   OE1  NE2                                  
REMARK 470     CYS F 982    SG                                                  
REMARK 470     ASP F 983    CG   OD1  OD2                                       
REMARK 470     ILE F 984    CG1  CG2  CD1                                       
REMARK 470     LEU F 985    CG   CD1  CD2                                       
REMARK 470     LYS F 986    CG   CD   CE   NZ                                   
REMARK 470     CYS F 987    SG                                                  
REMARK 470     HIS F 988    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ASN F 989    CG   OD1  ND2                                       
REMARK 470     TRP F 990    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F 990    CZ3  CH2                                            
REMARK 470     ASP F 991    CG   OD1  OD2                                       
REMARK 470     VAL F 993    CG1  CG2                                            
REMARK 470     ARG F 994    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     HIS F 995    CG   ND1  CD2  CE1  NE2                             
REMARK 470     SER F 996    OG                                                  
REMARK 470     ARG F 997    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS F 998    CG   CD   CE   NZ                                   
REMARK 470     HIS F 999    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU F1000    CG   CD1  CD2                                       
REMARK 470     TRP F1001    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP F1001    CZ3  CH2                                            
REMARK 470     PRO F1002    CG   CD                                             
REMARK 470     VAL F1003    CG1  CG2                                            
REMARK 470     VAL F1004    CG1  CG2                                            
REMARK 470     PRO F1005    CG   CD                                             
REMARK 470     ASP F1006    CG   OD1  OD2                                       
REMARK 470     ASP F1007    CG   OD1  OD2                                       
REMARK 470     VAL F1008    CG1  CG2                                            
REMARK 470     GLU F1009    CG   CD   OE1  OE2                                  
REMARK 470     GLN F1010    CG   CD   OE1  NE2                                  
REMARK 470     LEU F1011    CG   CD1  CD2                                       
REMARK 470     CYS F1012    SG                                                  
REMARK 470     ASN F1013    CG   OD1  ND2                                       
REMARK 470     GLU F1014    CG   CD   OE1  OE2                                  
REMARK 470     LEU F1015    CG   CD1  CD2                                       
REMARK 470     SER F1016    OG                                                  
REMARK 470     SER F1017    OG                                                  
REMARK 470     ILE F1018    CG1  CG2  CD1                                       
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    ARG A  83       31.95    -98.89                                   
REMARK 500    PRO A 120     -159.57    -70.00                                   
REMARK 500    VAL A 121      -29.18    -34.95                                   
REMARK 500    VAL A 187      -60.14   -120.75                                   
REMARK 500    ARG A 260       54.40    -92.96                                   
REMARK 500    TRP A 376       59.82    -94.00                                   
REMARK 500    ILE A 458      -58.60   -125.17                                   
REMARK 500    PRO A 529       44.99    -85.60                                   
REMARK 500    GLU A 617       34.08    -99.20                                   
REMARK 500    LEU A 630       34.57    -99.54                                   
REMARK 500    ILE A 780      -58.89   -121.10                                   
REMARK 500    PRO A 792      -20.58    -34.31                                   
REMARK 500    TRP A 816       33.27   -140.08                                   
REMARK 500    VAL A 855      -33.35    -39.93                                   
REMARK 500    PHE A 959       49.27    -85.05                                   
REMARK 500    ASP A 961       -0.59     57.35                                   
REMARK 500    GLN A 962      -52.84   -121.84                                   
REMARK 500    SER A 963       37.18    -98.58                                   
REMARK 500    MET A1044        5.12    -69.57                                   
REMARK 500    LEU A1169       34.08    -97.33                                   
REMARK 500    PHE A1191       34.64    -96.76                                   
REMARK 500    VAL A1198      -62.12   -104.06                                   
REMARK 500    VAL A1275      -61.78   -121.11                                   
REMARK 500    ASN A1330       50.70    -91.17                                   
REMARK 500    ALA A1361       31.79    -96.05                                   
REMARK 500    ILE A1412      -58.57   -120.19                                   
REMARK 500    TRP A1456       25.93   -141.20                                   
REMARK 500    CYS A1498       31.94    -95.13                                   
REMARK 500    GLU A1574       33.43    -98.77                                   
REMARK 500    SER A1597       33.15    -97.76                                   
REMARK 500    HIS A1693       73.61     52.63                                   
REMARK 500    ASP A1736       53.05    -91.88                                   
REMARK 500    ASN A1898       66.96   -101.36                                   
REMARK 500    TRP A1935       32.32    -96.88                                   
REMARK 500    HIS A1968       72.34     56.62                                   
REMARK 500    CYS A1999       33.56    -96.77                                   
REMARK 500    HIS A2001      -64.35    -95.06                                   
REMARK 500    VAL A2044      -62.09   -120.09                                   
REMARK 500    ALA A2056       36.69    -99.51                                   
REMARK 500    SER A2091      -36.56   -130.82                                   
REMARK 500    ARG A2134     -167.00   -125.15                                   
REMARK 500    ARG A2168       75.88     57.74                                   
REMARK 500    ASP A2274       41.46   -109.47                                   
REMARK 500    LYS A2283       31.98    -99.80                                   
REMARK 500    ASP A2360       30.03   -140.91                                   
REMARK 500    GLU A2363       -7.88     77.86                                   
REMARK 500    PHE A2371       75.36     53.04                                   
REMARK 500    GLU A2388     -167.43    -79.68                                   
REMARK 500    ARG A2408      -61.16    -95.17                                   
REMARK 500    GLN A2540       31.31    -96.04                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     135 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-6913   RELATED DB: EMDB                              
REMARK 900 4.9 ANGSTROM CRYO-EM STRUCTURE OF HUMAN MTOR COMPLEX 2               
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 1. FOR ENTITY 3 (CHAINS E/F), ENTIRE SEQUENCE HAS BEEN USED IN THE   
REMARK 999 EXPERIMENT. HOWEVER, C-TERMINAL THREE HELIX CANNOT BE ASSIGNED       
REMARK 999 ACCURATELY, AND WERE ASSIGNED TO RESIDUE NUMBER 1610-1626, 1630-     
REMARK 999 1649 AND 1680-1695 TEMPORARY. THE REAL SEQUENCE FOR RESIDUE 1019-    
REMARK 999 1708 SHOULD BE                                                       
REMARK 999 PSTLSLNSESTSSRHNSESESVPSSMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFP 
REMARK 999 FFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQ 
REMARK 999 KTLQLETS FMGNKHIEDTGSTPSIGENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFN 
REMARK 999 TDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVSTKTIKTSHYLTPQSNHLSLSKSNSVSLVP 
REMARK 999 PGSSHTLPRRAQSLKAP SIATIKSLADCNFSYTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAK 
REMARK 999 DVLFTDTITMKANSFESRLTPSRFMKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDY 
REMARK 999 IGLALPVDINDIFQVKDIPYFQTKNI PPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTE 
REMARK 999 IMNSIHSDASLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAICSHSDFQDIPYSDWCEQTI 
REMARK 999 HNPLEVVPSKFSGISGCSDGVSQEGSASSTKSTEL LLGVKTIPDDTPMCRILLRKEVLRLVINLSSS 
REMARK 999 VSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDVQFLQMHEEAEAVLA 
REMARK 999 TPPKQPIVDTSAES 2. FOR ENTITY 4 (CHAINS G/H), ENTIRE SEQUENCE HAS     
REMARK 999 BEEN USED IN THE EXPERIMENT. HOWEVER, ONLY N-TERMINAL RESIDUES       
REMARK 999 (SUPPOSED TO BE WITHIN RESIDUE RANGE 1-140) WERE ASSIGNED, BUT NOT   
REMARK 999 ACCURATELY. THE REAL SEQUENCE FOR RESIDUE 1-140 SHOULD BE:           
REMARK 999 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQ 
DBREF  5ZCS A    1  2549  UNP    P42345   MTOR_HUMAN       1   2549             
DBREF  5ZCS B    1  2549  UNP    P42345   MTOR_HUMAN       1   2549             
DBREF  5ZCS C    1   326  UNP    Q9BVC4   LST8_HUMAN       1    326             
DBREF  5ZCS D    1   326  UNP    Q9BVC4   LST8_HUMAN       1    326             
DBREF  5ZCS E    1  1018  UNP    Q6R327   RICTR_HUMAN      1   1018             
DBREF  5ZCS E 1019  1708  PDB    5ZCS     5ZCS          1019   1708             
DBREF  5ZCS F    1  1018  UNP    Q6R327   RICTR_HUMAN      1   1018             
DBREF  5ZCS F 1019  1708  PDB    5ZCS     5ZCS          1019   1708             
DBREF  5ZCS G    1   140  PDB    5ZCS     5ZCS             1    140             
DBREF  5ZCS G  141   522  UNP    Q9BPZ7   SIN1_HUMAN     141    522             
DBREF  5ZCS H    1   140  PDB    5ZCS     5ZCS             1    140             
DBREF  5ZCS H  141   522  UNP    Q9BPZ7   SIN1_HUMAN     141    522             
SEQRES   1 A 2549  MET LEU GLY THR GLY PRO ALA ALA ALA THR THR ALA ALA          
SEQRES   2 A 2549  THR THR SER SER ASN VAL SER VAL LEU GLN GLN PHE ALA          
SEQRES   3 A 2549  SER GLY LEU LYS SER ARG ASN GLU GLU THR ARG ALA LYS          
SEQRES   4 A 2549  ALA ALA LYS GLU LEU GLN HIS TYR VAL THR MET GLU LEU          
SEQRES   5 A 2549  ARG GLU MET SER GLN GLU GLU SER THR ARG PHE TYR ASP          
SEQRES   6 A 2549  GLN LEU ASN HIS HIS ILE PHE GLU LEU VAL SER SER SER          
SEQRES   7 A 2549  ASP ALA ASN GLU ARG LYS GLY GLY ILE LEU ALA ILE ALA          
SEQRES   8 A 2549  SER LEU ILE GLY VAL GLU GLY GLY ASN ALA THR ARG ILE          
SEQRES   9 A 2549  GLY ARG PHE ALA ASN TYR LEU ARG ASN LEU LEU PRO SER          
SEQRES  10 A 2549  ASN ASP PRO VAL VAL MET GLU MET ALA SER LYS ALA ILE          
SEQRES  11 A 2549  GLY ARG LEU ALA MET ALA GLY ASP THR PHE THR ALA GLU          
SEQRES  12 A 2549  TYR VAL GLU PHE GLU VAL LYS ARG ALA LEU GLU TRP LEU          
SEQRES  13 A 2549  GLY ALA ASP ARG ASN GLU GLY ARG ARG HIS ALA ALA VAL          
SEQRES  14 A 2549  LEU VAL LEU ARG GLU LEU ALA ILE SER VAL PRO THR PHE          
SEQRES  15 A 2549  PHE PHE GLN GLN VAL GLN PRO PHE PHE ASP ASN ILE PHE          
SEQRES  16 A 2549  VAL ALA VAL TRP ASP PRO LYS GLN ALA ILE ARG GLU GLY          
SEQRES  17 A 2549  ALA VAL ALA ALA LEU ARG ALA CYS LEU ILE LEU THR THR          
SEQRES  18 A 2549  GLN ARG GLU PRO LYS GLU MET GLN LYS PRO GLN TRP TYR          
SEQRES  19 A 2549  ARG HIS THR PHE GLU GLU ALA GLU LYS GLY PHE ASP GLU          
SEQRES  20 A 2549  THR LEU ALA LYS GLU LYS GLY MET ASN ARG ASP ASP ARG          
SEQRES  21 A 2549  ILE HIS GLY ALA LEU LEU ILE LEU ASN GLU LEU VAL ARG          
SEQRES  22 A 2549  ILE SER SER MET GLU GLY GLU ARG LEU ARG GLU GLU MET          
SEQRES  23 A 2549  GLU GLU ILE THR GLN GLN GLN LEU VAL HIS ASP LYS TYR          
SEQRES  24 A 2549  CYS LYS ASP LEU MET GLY PHE GLY THR LYS PRO ARG HIS          
SEQRES  25 A 2549  ILE THR PRO PHE THR SER PHE GLN ALA VAL GLN PRO GLN          
SEQRES  26 A 2549  GLN SER ASN ALA LEU VAL GLY LEU LEU GLY TYR SER SER          
SEQRES  27 A 2549  HIS GLN GLY LEU MET GLY PHE GLY THR SER PRO SER PRO          
SEQRES  28 A 2549  ALA LYS SER THR LEU VAL GLU SER ARG CYS CYS ARG ASP          
SEQRES  29 A 2549  LEU MET GLU GLU LYS PHE ASP GLN VAL CYS GLN TRP VAL          
SEQRES  30 A 2549  LEU LYS CYS ARG ASN SER LYS ASN SER LEU ILE GLN MET          
SEQRES  31 A 2549  THR ILE LEU ASN LEU LEU PRO ARG LEU ALA ALA PHE ARG          
SEQRES  32 A 2549  PRO SER ALA PHE THR ASP THR GLN TYR LEU GLN ASP THR          
SEQRES  33 A 2549  MET ASN HIS VAL LEU SER CYS VAL LYS LYS GLU LYS GLU          
SEQRES  34 A 2549  ARG THR ALA ALA PHE GLN ALA LEU GLY LEU LEU SER VAL          
SEQRES  35 A 2549  ALA VAL ARG SER GLU PHE LYS VAL TYR LEU PRO ARG VAL          
SEQRES  36 A 2549  LEU ASP ILE ILE ARG ALA ALA LEU PRO PRO LYS ASP PHE          
SEQRES  37 A 2549  ALA HIS LYS ARG GLN LYS ALA MET GLN VAL ASP ALA THR          
SEQRES  38 A 2549  VAL PHE THR CYS ILE SER MET LEU ALA ARG ALA MET GLY          
SEQRES  39 A 2549  PRO GLY ILE GLN GLN ASP ILE LYS GLU LEU LEU GLU PRO          
SEQRES  40 A 2549  MET LEU ALA VAL GLY LEU SER PRO ALA LEU THR ALA VAL          
SEQRES  41 A 2549  LEU TYR ASP LEU SER ARG GLN ILE PRO GLN LEU LYS LYS          
SEQRES  42 A 2549  ASP ILE GLN ASP GLY LEU LEU LYS MET LEU SER LEU VAL          
SEQRES  43 A 2549  LEU MET HIS LYS PRO LEU ARG HIS PRO GLY MET PRO LYS          
SEQRES  44 A 2549  GLY LEU ALA HIS GLN LEU ALA SER PRO GLY LEU THR THR          
SEQRES  45 A 2549  LEU PRO GLU ALA SER ASP VAL GLY SER ILE THR LEU ALA          
SEQRES  46 A 2549  LEU ARG THR LEU GLY SER PHE GLU PHE GLU GLY HIS SER          
SEQRES  47 A 2549  LEU THR GLN PHE VAL ARG HIS CYS ALA ASP HIS PHE LEU          
SEQRES  48 A 2549  ASN SER GLU HIS LYS GLU ILE ARG MET GLU ALA ALA ARG          
SEQRES  49 A 2549  THR CYS SER ARG LEU LEU THR PRO SER ILE HIS LEU ILE          
SEQRES  50 A 2549  SER GLY HIS ALA HIS VAL VAL SER GLN THR ALA VAL GLN          
SEQRES  51 A 2549  VAL VAL ALA ASP VAL LEU SER LYS LEU LEU VAL VAL GLY          
SEQRES  52 A 2549  ILE THR ASP PRO ASP PRO ASP ILE ARG TYR CYS VAL LEU          
SEQRES  53 A 2549  ALA SER LEU ASP GLU ARG PHE ASP ALA HIS LEU ALA GLN          
SEQRES  54 A 2549  ALA GLU ASN LEU GLN ALA LEU PHE VAL ALA LEU ASN ASP          
SEQRES  55 A 2549  GLN VAL PHE GLU ILE ARG GLU LEU ALA ILE CYS THR VAL          
SEQRES  56 A 2549  GLY ARG LEU SER SER MET ASN PRO ALA PHE VAL MET PRO          
SEQRES  57 A 2549  PHE LEU ARG LYS MET LEU ILE GLN ILE LEU THR GLU LEU          
SEQRES  58 A 2549  GLU HIS SER GLY ILE GLY ARG ILE LYS GLU GLN SER ALA          
SEQRES  59 A 2549  ARG MET LEU GLY HIS LEU VAL SER ASN ALA PRO ARG LEU          
SEQRES  60 A 2549  ILE ARG PRO TYR MET GLU PRO ILE LEU LYS ALA LEU ILE          
SEQRES  61 A 2549  LEU LYS LEU LYS ASP PRO ASP PRO ASP PRO ASN PRO GLY          
SEQRES  62 A 2549  VAL ILE ASN ASN VAL LEU ALA THR ILE GLY GLU LEU ALA          
SEQRES  63 A 2549  GLN VAL SER GLY LEU GLU MET ARG LYS TRP VAL ASP GLU          
SEQRES  64 A 2549  LEU PHE ILE ILE ILE MET ASP MET LEU GLN ASP SER SER          
SEQRES  65 A 2549  LEU LEU ALA LYS ARG GLN VAL ALA LEU TRP THR LEU GLY          
SEQRES  66 A 2549  GLN LEU VAL ALA SER THR GLY TYR VAL VAL GLU PRO TYR          
SEQRES  67 A 2549  ARG LYS TYR PRO THR LEU LEU GLU VAL LEU LEU ASN PHE          
SEQRES  68 A 2549  LEU LYS THR GLU GLN ASN GLN GLY THR ARG ARG GLU ALA          
SEQRES  69 A 2549  ILE ARG VAL LEU GLY LEU LEU GLY ALA LEU ASP PRO TYR          
SEQRES  70 A 2549  LYS HIS LYS VAL ASN ILE GLY MET ILE ASP GLN SER ARG          
SEQRES  71 A 2549  ASP ALA SER ALA VAL SER LEU SER GLU SER LYS SER SER          
SEQRES  72 A 2549  GLN ASP SER SER ASP TYR SER THR SER GLU MET LEU VAL          
SEQRES  73 A 2549  ASN MET GLY ASN LEU PRO LEU ASP GLU PHE TYR PRO ALA          
SEQRES  74 A 2549  VAL SER MET VAL ALA LEU MET ARG ILE PHE ARG ASP GLN          
SEQRES  75 A 2549  SER LEU SER HIS HIS HIS THR MET VAL VAL GLN ALA ILE          
SEQRES  76 A 2549  THR PHE ILE PHE LYS SER LEU GLY LEU LYS CYS VAL GLN          
SEQRES  77 A 2549  PHE LEU PRO GLN VAL MET PRO THR PHE LEU ASN VAL ILE          
SEQRES  78 A 2549  ARG VAL CYS ASP GLY ALA ILE ARG GLU PHE LEU PHE GLN          
SEQRES  79 A 2549  GLN LEU GLY MET LEU VAL SER PHE VAL LYS SER HIS ILE          
SEQRES  80 A 2549  ARG PRO TYR MET ASP GLU ILE VAL THR LEU MET ARG GLU          
SEQRES  81 A 2549  PHE TRP VAL MET ASN THR SER ILE GLN SER THR ILE ILE          
SEQRES  82 A 2549  LEU LEU ILE GLU GLN ILE VAL VAL ALA LEU GLY GLY GLU          
SEQRES  83 A 2549  PHE LYS LEU TYR LEU PRO GLN LEU ILE PRO HIS MET LEU          
SEQRES  84 A 2549  ARG VAL PHE MET HIS ASP ASN SER PRO GLY ARG ILE VAL          
SEQRES  85 A 2549  SER ILE LYS LEU LEU ALA ALA ILE GLN LEU PHE GLY ALA          
SEQRES  86 A 2549  ASN LEU ASP ASP TYR LEU HIS LEU LEU LEU PRO PRO ILE          
SEQRES  87 A 2549  VAL LYS LEU PHE ASP ALA PRO GLU ALA PRO LEU PRO SER          
SEQRES  88 A 2549  ARG LYS ALA ALA LEU GLU THR VAL ASP ARG LEU THR GLU          
SEQRES  89 A 2549  SER LEU ASP PHE THR ASP TYR ALA SER ARG ILE ILE HIS          
SEQRES  90 A 2549  PRO ILE VAL ARG THR LEU ASP GLN SER PRO GLU LEU ARG          
SEQRES  91 A 2549  SER THR ALA MET ASP THR LEU SER SER LEU VAL PHE GLN          
SEQRES  92 A 2549  LEU GLY LYS LYS TYR GLN ILE PHE ILE PRO MET VAL ASN          
SEQRES  93 A 2549  LYS VAL LEU VAL ARG HIS ARG ILE ASN HIS GLN ARG TYR          
SEQRES  94 A 2549  ASP VAL LEU ILE CYS ARG ILE VAL LYS GLY TYR THR LEU          
SEQRES  95 A 2549  ALA ASP GLU GLU GLU ASP PRO LEU ILE TYR GLN HIS ARG          
SEQRES  96 A 2549  MET LEU ARG SER GLY GLN GLY ASP ALA LEU ALA SER GLY          
SEQRES  97 A 2549  PRO VAL GLU THR GLY PRO MET LYS LYS LEU HIS VAL SER          
SEQRES  98 A 2549  THR ILE ASN LEU GLN LYS ALA TRP GLY ALA ALA ARG ARG          
SEQRES  99 A 2549  VAL SER LYS ASP ASP TRP LEU GLU TRP LEU ARG ARG LEU          
SEQRES 100 A 2549  SER LEU GLU LEU LEU LYS ASP SER SER SER PRO SER LEU          
SEQRES 101 A 2549  ARG SER CYS TRP ALA LEU ALA GLN ALA TYR ASN PRO MET          
SEQRES 102 A 2549  ALA ARG ASP LEU PHE ASN ALA ALA PHE VAL SER CYS TRP          
SEQRES 103 A 2549  SER GLU LEU ASN GLU ASP GLN GLN ASP GLU LEU ILE ARG          
SEQRES 104 A 2549  SER ILE GLU LEU ALA LEU THR SER GLN ASP ILE ALA GLU          
SEQRES 105 A 2549  VAL THR GLN THR LEU LEU ASN LEU ALA GLU PHE MET GLU          
SEQRES 106 A 2549  HIS SER ASP LYS GLY PRO LEU PRO LEU ARG ASP ASP ASN          
SEQRES 107 A 2549  GLY ILE VAL LEU LEU GLY GLU ARG ALA ALA LYS CYS ARG          
SEQRES 108 A 2549  ALA TYR ALA LYS ALA LEU HIS TYR LYS GLU LEU GLU PHE          
SEQRES 109 A 2549  GLN LYS GLY PRO THR PRO ALA ILE LEU GLU SER LEU ILE          
SEQRES 110 A 2549  SER ILE ASN ASN LYS LEU GLN GLN PRO GLU ALA ALA ALA          
SEQRES 111 A 2549  GLY VAL LEU GLU TYR ALA MET LYS HIS PHE GLY GLU LEU          
SEQRES 112 A 2549  GLU ILE GLN ALA THR TRP TYR GLU LYS LEU HIS GLU TRP          
SEQRES 113 A 2549  GLU ASP ALA LEU VAL ALA TYR ASP LYS LYS MET ASP THR          
SEQRES 114 A 2549  ASN LYS ASP ASP PRO GLU LEU MET LEU GLY ARG MET ARG          
SEQRES 115 A 2549  CYS LEU GLU ALA LEU GLY GLU TRP GLY GLN LEU HIS GLN          
SEQRES 116 A 2549  GLN CYS CYS GLU LYS TRP THR LEU VAL ASN ASP GLU THR          
SEQRES 117 A 2549  GLN ALA LYS MET ALA ARG MET ALA ALA ALA ALA ALA TRP          
SEQRES 118 A 2549  GLY LEU GLY GLN TRP ASP SER MET GLU GLU TYR THR CYS          
SEQRES 119 A 2549  MET ILE PRO ARG ASP THR HIS ASP GLY ALA PHE TYR ARG          
SEQRES 120 A 2549  ALA VAL LEU ALA LEU HIS GLN ASP LEU PHE SER LEU ALA          
SEQRES 121 A 2549  GLN GLN CYS ILE ASP LYS ALA ARG ASP LEU LEU ASP ALA          
SEQRES 122 A 2549  GLU LEU THR ALA MET ALA GLY GLU SER TYR SER ARG ALA          
SEQRES 123 A 2549  TYR GLY ALA MET VAL SER CYS HIS MET LEU SER GLU LEU          
SEQRES 124 A 2549  GLU GLU VAL ILE GLN TYR LYS LEU VAL PRO GLU ARG ARG          
SEQRES 125 A 2549  GLU ILE ILE ARG GLN ILE TRP TRP GLU ARG LEU GLN GLY          
SEQRES 126 A 2549  CYS GLN ARG ILE VAL GLU ASP TRP GLN LYS ILE LEU MET          
SEQRES 127 A 2549  VAL ARG SER LEU VAL VAL SER PRO HIS GLU ASP MET ARG          
SEQRES 128 A 2549  THR TRP LEU LYS TYR ALA SER LEU CYS GLY LYS SER GLY          
SEQRES 129 A 2549  ARG LEU ALA LEU ALA HIS LYS THR LEU VAL LEU LEU LEU          
SEQRES 130 A 2549  GLY VAL ASP PRO SER ARG GLN LEU ASP HIS PRO LEU PRO          
SEQRES 131 A 2549  THR VAL HIS PRO GLN VAL THR TYR ALA TYR MET LYS ASN          
SEQRES 132 A 2549  MET TRP LYS SER ALA ARG LYS ILE ASP ALA PHE GLN HIS          
SEQRES 133 A 2549  MET GLN HIS PHE VAL GLN THR MET GLN GLN GLN ALA GLN          
SEQRES 134 A 2549  HIS ALA ILE ALA THR GLU ASP GLN GLN HIS LYS GLN GLU          
SEQRES 135 A 2549  LEU HIS LYS LEU MET ALA ARG CYS PHE LEU LYS LEU GLY          
SEQRES 136 A 2549  GLU TRP GLN LEU ASN LEU GLN GLY ILE ASN GLU SER THR          
SEQRES 137 A 2549  ILE PRO LYS VAL LEU GLN TYR TYR SER ALA ALA THR GLU          
SEQRES 138 A 2549  HIS ASP ARG SER TRP TYR LYS ALA TRP HIS ALA TRP ALA          
SEQRES 139 A 2549  VAL MET ASN PHE GLU ALA VAL LEU HIS TYR LYS HIS GLN          
SEQRES 140 A 2549  ASN GLN ALA ARG ASP GLU LYS LYS LYS LEU ARG HIS ALA          
SEQRES 141 A 2549  SER GLY ALA ASN ILE THR ASN ALA THR THR ALA ALA THR          
SEQRES 142 A 2549  THR ALA ALA THR ALA THR THR THR ALA SER THR GLU GLY          
SEQRES 143 A 2549  SER ASN SER GLU SER GLU ALA GLU SER THR GLU ASN SER          
SEQRES 144 A 2549  PRO THR PRO SER PRO LEU GLN LYS LYS VAL THR GLU ASP          
SEQRES 145 A 2549  LEU SER LYS THR LEU LEU MET TYR THR VAL PRO ALA VAL          
SEQRES 146 A 2549  GLN GLY PHE PHE ARG SER ILE SER LEU SER ARG GLY ASN          
SEQRES 147 A 2549  ASN LEU GLN ASP THR LEU ARG VAL LEU THR LEU TRP PHE          
SEQRES 148 A 2549  ASP TYR GLY HIS TRP PRO ASP VAL ASN GLU ALA LEU VAL          
SEQRES 149 A 2549  GLU GLY VAL LYS ALA ILE GLN ILE ASP THR TRP LEU GLN          
SEQRES 150 A 2549  VAL ILE PRO GLN LEU ILE ALA ARG ILE ASP THR PRO ARG          
SEQRES 151 A 2549  PRO LEU VAL GLY ARG LEU ILE HIS GLN LEU LEU THR ASP          
SEQRES 152 A 2549  ILE GLY ARG TYR HIS PRO GLN ALA LEU ILE TYR PRO LEU          
SEQRES 153 A 2549  THR VAL ALA SER LYS SER THR THR THR ALA ARG HIS ASN          
SEQRES 154 A 2549  ALA ALA ASN LYS ILE LEU LYS ASN MET CYS GLU HIS SER          
SEQRES 155 A 2549  ASN THR LEU VAL GLN GLN ALA MET MET VAL SER GLU GLU          
SEQRES 156 A 2549  LEU ILE ARG VAL ALA ILE LEU TRP HIS GLU MET TRP HIS          
SEQRES 157 A 2549  GLU GLY LEU GLU GLU ALA SER ARG LEU TYR PHE GLY GLU          
SEQRES 158 A 2549  ARG ASN VAL LYS GLY MET PHE GLU VAL LEU GLU PRO LEU          
SEQRES 159 A 2549  HIS ALA MET MET GLU ARG GLY PRO GLN THR LEU LYS GLU          
SEQRES 160 A 2549  THR SER PHE ASN GLN ALA TYR GLY ARG ASP LEU MET GLU          
SEQRES 161 A 2549  ALA GLN GLU TRP CYS ARG LYS TYR MET LYS SER GLY ASN          
SEQRES 162 A 2549  VAL LYS ASP LEU THR GLN ALA TRP ASP LEU TYR TYR HIS          
SEQRES 163 A 2549  VAL PHE ARG ARG ILE SER LYS GLN LEU PRO GLN LEU THR          
SEQRES 164 A 2549  SER LEU GLU LEU GLN TYR VAL SER PRO LYS LEU LEU MET          
SEQRES 165 A 2549  CYS ARG ASP LEU GLU LEU ALA VAL PRO GLY THR TYR ASP          
SEQRES 166 A 2549  PRO ASN GLN PRO ILE ILE ARG ILE GLN SER ILE ALA PRO          
SEQRES 167 A 2549  SER LEU GLN VAL ILE THR SER LYS GLN ARG PRO ARG LYS          
SEQRES 168 A 2549  LEU THR LEU MET GLY SER ASN GLY HIS GLU PHE VAL PHE          
SEQRES 169 A 2549  LEU LEU LYS GLY HIS GLU ASP LEU ARG GLN ASP GLU ARG          
SEQRES 170 A 2549  VAL MET GLN LEU PHE GLY LEU VAL ASN THR LEU LEU ALA          
SEQRES 171 A 2549  ASN ASP PRO THR SER LEU ARG LYS ASN LEU SER ILE GLN          
SEQRES 172 A 2549  ARG TYR ALA VAL ILE PRO LEU SER THR ASN SER GLY LEU          
SEQRES 173 A 2549  ILE GLY TRP VAL PRO HIS CYS ASP THR LEU HIS ALA LEU          
SEQRES 174 A 2549  ILE ARG ASP TYR ARG GLU LYS LYS LYS ILE LEU LEU ASN          
SEQRES 175 A 2549  ILE GLU HIS ARG ILE MET LEU ARG MET ALA PRO ASP TYR          
SEQRES 176 A 2549  ASP HIS LEU THR LEU MET GLN LYS VAL GLU VAL PHE GLU          
SEQRES 177 A 2549  HIS ALA VAL ASN ASN THR ALA GLY ASP ASP LEU ALA LYS          
SEQRES 178 A 2549  LEU LEU TRP LEU LYS SER PRO SER SER GLU VAL TRP PHE          
SEQRES 179 A 2549  ASP ARG ARG THR ASN TYR THR ARG SER LEU ALA VAL MET          
SEQRES 180 A 2549  SER MET VAL GLY TYR ILE LEU GLY LEU GLY ASP ARG HIS          
SEQRES 181 A 2549  PRO SER ASN LEU MET LEU ASP ARG LEU SER GLY LYS ILE          
SEQRES 182 A 2549  LEU HIS ILE ASP PHE GLY ASP CYS PHE GLU VAL ALA MET          
SEQRES 183 A 2549  THR ARG GLU LYS PHE PRO GLU LYS ILE PRO PHE ARG LEU          
SEQRES 184 A 2549  THR ARG MET LEU THR ASN ALA MET GLU VAL THR GLY LEU          
SEQRES 185 A 2549  ASP GLY ASN TYR ARG ILE THR CYS HIS THR VAL MET GLU          
SEQRES 186 A 2549  VAL LEU ARG GLU HIS LYS ASP SER VAL MET ALA VAL LEU          
SEQRES 187 A 2549  GLU ALA PHE VAL TYR ASP PRO LEU LEU ASN TRP ARG LEU          
SEQRES 188 A 2549  MET ASP THR ASN THR LYS GLY ASN LYS ARG SER ARG THR          
SEQRES 189 A 2549  ARG THR ASP SER TYR SER ALA GLY GLN SER VAL GLU ILE          
SEQRES 190 A 2549  LEU ASP GLY VAL GLU LEU GLY GLU PRO ALA HIS LYS LYS          
SEQRES 191 A 2549  THR GLY THR THR VAL PRO GLU SER ILE HIS SER PHE ILE          
SEQRES 192 A 2549  GLY ASP GLY LEU VAL LYS PRO GLU ALA LEU ASN LYS LYS          
SEQRES 193 A 2549  ALA ILE GLN ILE ILE ASN ARG VAL ARG ASP LYS LEU THR          
SEQRES 194 A 2549  GLY ARG ASP PHE SER HIS ASP ASP THR LEU ASP VAL PRO          
SEQRES 195 A 2549  THR GLN VAL GLU LEU LEU ILE LYS GLN ALA THR SER HIS          
SEQRES 196 A 2549  GLU ASN LEU CYS GLN CYS TYR ILE GLY TRP CYS PRO PHE          
SEQRES 197 A 2549  TRP                                                          
SEQRES   1 B 2549  MET LEU GLY THR GLY PRO ALA ALA ALA THR THR ALA ALA          
SEQRES   2 B 2549  THR THR SER SER ASN VAL SER VAL LEU GLN GLN PHE ALA          
SEQRES   3 B 2549  SER GLY LEU LYS SER ARG ASN GLU GLU THR ARG ALA LYS          
SEQRES   4 B 2549  ALA ALA LYS GLU LEU GLN HIS TYR VAL THR MET GLU LEU          
SEQRES   5 B 2549  ARG GLU MET SER GLN GLU GLU SER THR ARG PHE TYR ASP          
SEQRES   6 B 2549  GLN LEU ASN HIS HIS ILE PHE GLU LEU VAL SER SER SER          
SEQRES   7 B 2549  ASP ALA ASN GLU ARG LYS GLY GLY ILE LEU ALA ILE ALA          
SEQRES   8 B 2549  SER LEU ILE GLY VAL GLU GLY GLY ASN ALA THR ARG ILE          
SEQRES   9 B 2549  GLY ARG PHE ALA ASN TYR LEU ARG ASN LEU LEU PRO SER          
SEQRES  10 B 2549  ASN ASP PRO VAL VAL MET GLU MET ALA SER LYS ALA ILE          
SEQRES  11 B 2549  GLY ARG LEU ALA MET ALA GLY ASP THR PHE THR ALA GLU          
SEQRES  12 B 2549  TYR VAL GLU PHE GLU VAL LYS ARG ALA LEU GLU TRP LEU          
SEQRES  13 B 2549  GLY ALA ASP ARG ASN GLU GLY ARG ARG HIS ALA ALA VAL          
SEQRES  14 B 2549  LEU VAL LEU ARG GLU LEU ALA ILE SER VAL PRO THR PHE          
SEQRES  15 B 2549  PHE PHE GLN GLN VAL GLN PRO PHE PHE ASP ASN ILE PHE          
SEQRES  16 B 2549  VAL ALA VAL TRP ASP PRO LYS GLN ALA ILE ARG GLU GLY          
SEQRES  17 B 2549  ALA VAL ALA ALA LEU ARG ALA CYS LEU ILE LEU THR THR          
SEQRES  18 B 2549  GLN ARG GLU PRO LYS GLU MET GLN LYS PRO GLN TRP TYR          
SEQRES  19 B 2549  ARG HIS THR PHE GLU GLU ALA GLU LYS GLY PHE ASP GLU          
SEQRES  20 B 2549  THR LEU ALA LYS GLU LYS GLY MET ASN ARG ASP ASP ARG          
SEQRES  21 B 2549  ILE HIS GLY ALA LEU LEU ILE LEU ASN GLU LEU VAL ARG          
SEQRES  22 B 2549  ILE SER SER MET GLU GLY GLU ARG LEU ARG GLU GLU MET          
SEQRES  23 B 2549  GLU GLU ILE THR GLN GLN GLN LEU VAL HIS ASP LYS TYR          
SEQRES  24 B 2549  CYS LYS ASP LEU MET GLY PHE GLY THR LYS PRO ARG HIS          
SEQRES  25 B 2549  ILE THR PRO PHE THR SER PHE GLN ALA VAL GLN PRO GLN          
SEQRES  26 B 2549  GLN SER ASN ALA LEU VAL GLY LEU LEU GLY TYR SER SER          
SEQRES  27 B 2549  HIS GLN GLY LEU MET GLY PHE GLY THR SER PRO SER PRO          
SEQRES  28 B 2549  ALA LYS SER THR LEU VAL GLU SER ARG CYS CYS ARG ASP          
SEQRES  29 B 2549  LEU MET GLU GLU LYS PHE ASP GLN VAL CYS GLN TRP VAL          
SEQRES  30 B 2549  LEU LYS CYS ARG ASN SER LYS ASN SER LEU ILE GLN MET          
SEQRES  31 B 2549  THR ILE LEU ASN LEU LEU PRO ARG LEU ALA ALA PHE ARG          
SEQRES  32 B 2549  PRO SER ALA PHE THR ASP THR GLN TYR LEU GLN ASP THR          
SEQRES  33 B 2549  MET ASN HIS VAL LEU SER CYS VAL LYS LYS GLU LYS GLU          
SEQRES  34 B 2549  ARG THR ALA ALA PHE GLN ALA LEU GLY LEU LEU SER VAL          
SEQRES  35 B 2549  ALA VAL ARG SER GLU PHE LYS VAL TYR LEU PRO ARG VAL          
SEQRES  36 B 2549  LEU ASP ILE ILE ARG ALA ALA LEU PRO PRO LYS ASP PHE          
SEQRES  37 B 2549  ALA HIS LYS ARG GLN LYS ALA MET GLN VAL ASP ALA THR          
SEQRES  38 B 2549  VAL PHE THR CYS ILE SER MET LEU ALA ARG ALA MET GLY          
SEQRES  39 B 2549  PRO GLY ILE GLN GLN ASP ILE LYS GLU LEU LEU GLU PRO          
SEQRES  40 B 2549  MET LEU ALA VAL GLY LEU SER PRO ALA LEU THR ALA VAL          
SEQRES  41 B 2549  LEU TYR ASP LEU SER ARG GLN ILE PRO GLN LEU LYS LYS          
SEQRES  42 B 2549  ASP ILE GLN ASP GLY LEU LEU LYS MET LEU SER LEU VAL          
SEQRES  43 B 2549  LEU MET HIS LYS PRO LEU ARG HIS PRO GLY MET PRO LYS          
SEQRES  44 B 2549  GLY LEU ALA HIS GLN LEU ALA SER PRO GLY LEU THR THR          
SEQRES  45 B 2549  LEU PRO GLU ALA SER ASP VAL GLY SER ILE THR LEU ALA          
SEQRES  46 B 2549  LEU ARG THR LEU GLY SER PHE GLU PHE GLU GLY HIS SER          
SEQRES  47 B 2549  LEU THR GLN PHE VAL ARG HIS CYS ALA ASP HIS PHE LEU          
SEQRES  48 B 2549  ASN SER GLU HIS LYS GLU ILE ARG MET GLU ALA ALA ARG          
SEQRES  49 B 2549  THR CYS SER ARG LEU LEU THR PRO SER ILE HIS LEU ILE          
SEQRES  50 B 2549  SER GLY HIS ALA HIS VAL VAL SER GLN THR ALA VAL GLN          
SEQRES  51 B 2549  VAL VAL ALA ASP VAL LEU SER LYS LEU LEU VAL VAL GLY          
SEQRES  52 B 2549  ILE THR ASP PRO ASP PRO ASP ILE ARG TYR CYS VAL LEU          
SEQRES  53 B 2549  ALA SER LEU ASP GLU ARG PHE ASP ALA HIS LEU ALA GLN          
SEQRES  54 B 2549  ALA GLU ASN LEU GLN ALA LEU PHE VAL ALA LEU ASN ASP          
SEQRES  55 B 2549  GLN VAL PHE GLU ILE ARG GLU LEU ALA ILE CYS THR VAL          
SEQRES  56 B 2549  GLY ARG LEU SER SER MET ASN PRO ALA PHE VAL MET PRO          
SEQRES  57 B 2549  PHE LEU ARG LYS MET LEU ILE GLN ILE LEU THR GLU LEU          
SEQRES  58 B 2549  GLU HIS SER GLY ILE GLY ARG ILE LYS GLU GLN SER ALA          
SEQRES  59 B 2549  ARG MET LEU GLY HIS LEU VAL SER ASN ALA PRO ARG LEU          
SEQRES  60 B 2549  ILE ARG PRO TYR MET GLU PRO ILE LEU LYS ALA LEU ILE          
SEQRES  61 B 2549  LEU LYS LEU LYS ASP PRO ASP PRO ASP PRO ASN PRO GLY          
SEQRES  62 B 2549  VAL ILE ASN ASN VAL LEU ALA THR ILE GLY GLU LEU ALA          
SEQRES  63 B 2549  GLN VAL SER GLY LEU GLU MET ARG LYS TRP VAL ASP GLU          
SEQRES  64 B 2549  LEU PHE ILE ILE ILE MET ASP MET LEU GLN ASP SER SER          
SEQRES  65 B 2549  LEU LEU ALA LYS ARG GLN VAL ALA LEU TRP THR LEU GLY          
SEQRES  66 B 2549  GLN LEU VAL ALA SER THR GLY TYR VAL VAL GLU PRO TYR          
SEQRES  67 B 2549  ARG LYS TYR PRO THR LEU LEU GLU VAL LEU LEU ASN PHE          
SEQRES  68 B 2549  LEU LYS THR GLU GLN ASN GLN GLY THR ARG ARG GLU ALA          
SEQRES  69 B 2549  ILE ARG VAL LEU GLY LEU LEU GLY ALA LEU ASP PRO TYR          
SEQRES  70 B 2549  LYS HIS LYS VAL ASN ILE GLY MET ILE ASP GLN SER ARG          
SEQRES  71 B 2549  ASP ALA SER ALA VAL SER LEU SER GLU SER LYS SER SER          
SEQRES  72 B 2549  GLN ASP SER SER ASP TYR SER THR SER GLU MET LEU VAL          
SEQRES  73 B 2549  ASN MET GLY ASN LEU PRO LEU ASP GLU PHE TYR PRO ALA          
SEQRES  74 B 2549  VAL SER MET VAL ALA LEU MET ARG ILE PHE ARG ASP GLN          
SEQRES  75 B 2549  SER LEU SER HIS HIS HIS THR MET VAL VAL GLN ALA ILE          
SEQRES  76 B 2549  THR PHE ILE PHE LYS SER LEU GLY LEU LYS CYS VAL GLN          
SEQRES  77 B 2549  PHE LEU PRO GLN VAL MET PRO THR PHE LEU ASN VAL ILE          
SEQRES  78 B 2549  ARG VAL CYS ASP GLY ALA ILE ARG GLU PHE LEU PHE GLN          
SEQRES  79 B 2549  GLN LEU GLY MET LEU VAL SER PHE VAL LYS SER HIS ILE          
SEQRES  80 B 2549  ARG PRO TYR MET ASP GLU ILE VAL THR LEU MET ARG GLU          
SEQRES  81 B 2549  PHE TRP VAL MET ASN THR SER ILE GLN SER THR ILE ILE          
SEQRES  82 B 2549  LEU LEU ILE GLU GLN ILE VAL VAL ALA LEU GLY GLY GLU          
SEQRES  83 B 2549  PHE LYS LEU TYR LEU PRO GLN LEU ILE PRO HIS MET LEU          
SEQRES  84 B 2549  ARG VAL PHE MET HIS ASP ASN SER PRO GLY ARG ILE VAL          
SEQRES  85 B 2549  SER ILE LYS LEU LEU ALA ALA ILE GLN LEU PHE GLY ALA          
SEQRES  86 B 2549  ASN LEU ASP ASP TYR LEU HIS LEU LEU LEU PRO PRO ILE          
SEQRES  87 B 2549  VAL LYS LEU PHE ASP ALA PRO GLU ALA PRO LEU PRO SER          
SEQRES  88 B 2549  ARG LYS ALA ALA LEU GLU THR VAL ASP ARG LEU THR GLU          
SEQRES  89 B 2549  SER LEU ASP PHE THR ASP TYR ALA SER ARG ILE ILE HIS          
SEQRES  90 B 2549  PRO ILE VAL ARG THR LEU ASP GLN SER PRO GLU LEU ARG          
SEQRES  91 B 2549  SER THR ALA MET ASP THR LEU SER SER LEU VAL PHE GLN          
SEQRES  92 B 2549  LEU GLY LYS LYS TYR GLN ILE PHE ILE PRO MET VAL ASN          
SEQRES  93 B 2549  LYS VAL LEU VAL ARG HIS ARG ILE ASN HIS GLN ARG TYR          
SEQRES  94 B 2549  ASP VAL LEU ILE CYS ARG ILE VAL LYS GLY TYR THR LEU          
SEQRES  95 B 2549  ALA ASP GLU GLU GLU ASP PRO LEU ILE TYR GLN HIS ARG          
SEQRES  96 B 2549  MET LEU ARG SER GLY GLN GLY ASP ALA LEU ALA SER GLY          
SEQRES  97 B 2549  PRO VAL GLU THR GLY PRO MET LYS LYS LEU HIS VAL SER          
SEQRES  98 B 2549  THR ILE ASN LEU GLN LYS ALA TRP GLY ALA ALA ARG ARG          
SEQRES  99 B 2549  VAL SER LYS ASP ASP TRP LEU GLU TRP LEU ARG ARG LEU          
SEQRES 100 B 2549  SER LEU GLU LEU LEU LYS ASP SER SER SER PRO SER LEU          
SEQRES 101 B 2549  ARG SER CYS TRP ALA LEU ALA GLN ALA TYR ASN PRO MET          
SEQRES 102 B 2549  ALA ARG ASP LEU PHE ASN ALA ALA PHE VAL SER CYS TRP          
SEQRES 103 B 2549  SER GLU LEU ASN GLU ASP GLN GLN ASP GLU LEU ILE ARG          
SEQRES 104 B 2549  SER ILE GLU LEU ALA LEU THR SER GLN ASP ILE ALA GLU          
SEQRES 105 B 2549  VAL THR GLN THR LEU LEU ASN LEU ALA GLU PHE MET GLU          
SEQRES 106 B 2549  HIS SER ASP LYS GLY PRO LEU PRO LEU ARG ASP ASP ASN          
SEQRES 107 B 2549  GLY ILE VAL LEU LEU GLY GLU ARG ALA ALA LYS CYS ARG          
SEQRES 108 B 2549  ALA TYR ALA LYS ALA LEU HIS TYR LYS GLU LEU GLU PHE          
SEQRES 109 B 2549  GLN LYS GLY PRO THR PRO ALA ILE LEU GLU SER LEU ILE          
SEQRES 110 B 2549  SER ILE ASN ASN LYS LEU GLN GLN PRO GLU ALA ALA ALA          
SEQRES 111 B 2549  GLY VAL LEU GLU TYR ALA MET LYS HIS PHE GLY GLU LEU          
SEQRES 112 B 2549  GLU ILE GLN ALA THR TRP TYR GLU LYS LEU HIS GLU TRP          
SEQRES 113 B 2549  GLU ASP ALA LEU VAL ALA TYR ASP LYS LYS MET ASP THR          
SEQRES 114 B 2549  ASN LYS ASP ASP PRO GLU LEU MET LEU GLY ARG MET ARG          
SEQRES 115 B 2549  CYS LEU GLU ALA LEU GLY GLU TRP GLY GLN LEU HIS GLN          
SEQRES 116 B 2549  GLN CYS CYS GLU LYS TRP THR LEU VAL ASN ASP GLU THR          
SEQRES 117 B 2549  GLN ALA LYS MET ALA ARG MET ALA ALA ALA ALA ALA TRP          
SEQRES 118 B 2549  GLY LEU GLY GLN TRP ASP SER MET GLU GLU TYR THR CYS          
SEQRES 119 B 2549  MET ILE PRO ARG ASP THR HIS ASP GLY ALA PHE TYR ARG          
SEQRES 120 B 2549  ALA VAL LEU ALA LEU HIS GLN ASP LEU PHE SER LEU ALA          
SEQRES 121 B 2549  GLN GLN CYS ILE ASP LYS ALA ARG ASP LEU LEU ASP ALA          
SEQRES 122 B 2549  GLU LEU THR ALA MET ALA GLY GLU SER TYR SER ARG ALA          
SEQRES 123 B 2549  TYR GLY ALA MET VAL SER CYS HIS MET LEU SER GLU LEU          
SEQRES 124 B 2549  GLU GLU VAL ILE GLN TYR LYS LEU VAL PRO GLU ARG ARG          
SEQRES 125 B 2549  GLU ILE ILE ARG GLN ILE TRP TRP GLU ARG LEU GLN GLY          
SEQRES 126 B 2549  CYS GLN ARG ILE VAL GLU ASP TRP GLN LYS ILE LEU MET          
SEQRES 127 B 2549  VAL ARG SER LEU VAL VAL SER PRO HIS GLU ASP MET ARG          
SEQRES 128 B 2549  THR TRP LEU LYS TYR ALA SER LEU CYS GLY LYS SER GLY          
SEQRES 129 B 2549  ARG LEU ALA LEU ALA HIS LYS THR LEU VAL LEU LEU LEU          
SEQRES 130 B 2549  GLY VAL ASP PRO SER ARG GLN LEU ASP HIS PRO LEU PRO          
SEQRES 131 B 2549  THR VAL HIS PRO GLN VAL THR TYR ALA TYR MET LYS ASN          
SEQRES 132 B 2549  MET TRP LYS SER ALA ARG LYS ILE ASP ALA PHE GLN HIS          
SEQRES 133 B 2549  MET GLN HIS PHE VAL GLN THR MET GLN GLN GLN ALA GLN          
SEQRES 134 B 2549  HIS ALA ILE ALA THR GLU ASP GLN GLN HIS LYS GLN GLU          
SEQRES 135 B 2549  LEU HIS LYS LEU MET ALA ARG CYS PHE LEU LYS LEU GLY          
SEQRES 136 B 2549  GLU TRP GLN LEU ASN LEU GLN GLY ILE ASN GLU SER THR          
SEQRES 137 B 2549  ILE PRO LYS VAL LEU GLN TYR TYR SER ALA ALA THR GLU          
SEQRES 138 B 2549  HIS ASP ARG SER TRP TYR LYS ALA TRP HIS ALA TRP ALA          
SEQRES 139 B 2549  VAL MET ASN PHE GLU ALA VAL LEU HIS TYR LYS HIS GLN          
SEQRES 140 B 2549  ASN GLN ALA ARG ASP GLU LYS LYS LYS LEU ARG HIS ALA          
SEQRES 141 B 2549  SER GLY ALA ASN ILE THR ASN ALA THR THR ALA ALA THR          
SEQRES 142 B 2549  THR ALA ALA THR ALA THR THR THR ALA SER THR GLU GLY          
SEQRES 143 B 2549  SER ASN SER GLU SER GLU ALA GLU SER THR GLU ASN SER          
SEQRES 144 B 2549  PRO THR PRO SER PRO LEU GLN LYS LYS VAL THR GLU ASP          
SEQRES 145 B 2549  LEU SER LYS THR LEU LEU MET TYR THR VAL PRO ALA VAL          
SEQRES 146 B 2549  GLN GLY PHE PHE ARG SER ILE SER LEU SER ARG GLY ASN          
SEQRES 147 B 2549  ASN LEU GLN ASP THR LEU ARG VAL LEU THR LEU TRP PHE          
SEQRES 148 B 2549  ASP TYR GLY HIS TRP PRO ASP VAL ASN GLU ALA LEU VAL          
SEQRES 149 B 2549  GLU GLY VAL LYS ALA ILE GLN ILE ASP THR TRP LEU GLN          
SEQRES 150 B 2549  VAL ILE PRO GLN LEU ILE ALA ARG ILE ASP THR PRO ARG          
SEQRES 151 B 2549  PRO LEU VAL GLY ARG LEU ILE HIS GLN LEU LEU THR ASP          
SEQRES 152 B 2549  ILE GLY ARG TYR HIS PRO GLN ALA LEU ILE TYR PRO LEU          
SEQRES 153 B 2549  THR VAL ALA SER LYS SER THR THR THR ALA ARG HIS ASN          
SEQRES 154 B 2549  ALA ALA ASN LYS ILE LEU LYS ASN MET CYS GLU HIS SER          
SEQRES 155 B 2549  ASN THR LEU VAL GLN GLN ALA MET MET VAL SER GLU GLU          
SEQRES 156 B 2549  LEU ILE ARG VAL ALA ILE LEU TRP HIS GLU MET TRP HIS          
SEQRES 157 B 2549  GLU GLY LEU GLU GLU ALA SER ARG LEU TYR PHE GLY GLU          
SEQRES 158 B 2549  ARG ASN VAL LYS GLY MET PHE GLU VAL LEU GLU PRO LEU          
SEQRES 159 B 2549  HIS ALA MET MET GLU ARG GLY PRO GLN THR LEU LYS GLU          
SEQRES 160 B 2549  THR SER PHE ASN GLN ALA TYR GLY ARG ASP LEU MET GLU          
SEQRES 161 B 2549  ALA GLN GLU TRP CYS ARG LYS TYR MET LYS SER GLY ASN          
SEQRES 162 B 2549  VAL LYS ASP LEU THR GLN ALA TRP ASP LEU TYR TYR HIS          
SEQRES 163 B 2549  VAL PHE ARG ARG ILE SER LYS GLN LEU PRO GLN LEU THR          
SEQRES 164 B 2549  SER LEU GLU LEU GLN TYR VAL SER PRO LYS LEU LEU MET          
SEQRES 165 B 2549  CYS ARG ASP LEU GLU LEU ALA VAL PRO GLY THR TYR ASP          
SEQRES 166 B 2549  PRO ASN GLN PRO ILE ILE ARG ILE GLN SER ILE ALA PRO          
SEQRES 167 B 2549  SER LEU GLN VAL ILE THR SER LYS GLN ARG PRO ARG LYS          
SEQRES 168 B 2549  LEU THR LEU MET GLY SER ASN GLY HIS GLU PHE VAL PHE          
SEQRES 169 B 2549  LEU LEU LYS GLY HIS GLU ASP LEU ARG GLN ASP GLU ARG          
SEQRES 170 B 2549  VAL MET GLN LEU PHE GLY LEU VAL ASN THR LEU LEU ALA          
SEQRES 171 B 2549  ASN ASP PRO THR SER LEU ARG LYS ASN LEU SER ILE GLN          
SEQRES 172 B 2549  ARG TYR ALA VAL ILE PRO LEU SER THR ASN SER GLY LEU          
SEQRES 173 B 2549  ILE GLY TRP VAL PRO HIS CYS ASP THR LEU HIS ALA LEU          
SEQRES 174 B 2549  ILE ARG ASP TYR ARG GLU LYS LYS LYS ILE LEU LEU ASN          
SEQRES 175 B 2549  ILE GLU HIS ARG ILE MET LEU ARG MET ALA PRO ASP TYR          
SEQRES 176 B 2549  ASP HIS LEU THR LEU MET GLN LYS VAL GLU VAL PHE GLU          
SEQRES 177 B 2549  HIS ALA VAL ASN ASN THR ALA GLY ASP ASP LEU ALA LYS          
SEQRES 178 B 2549  LEU LEU TRP LEU LYS SER PRO SER SER GLU VAL TRP PHE          
SEQRES 179 B 2549  ASP ARG ARG THR ASN TYR THR ARG SER LEU ALA VAL MET          
SEQRES 180 B 2549  SER MET VAL GLY TYR ILE LEU GLY LEU GLY ASP ARG HIS          
SEQRES 181 B 2549  PRO SER ASN LEU MET LEU ASP ARG LEU SER GLY LYS ILE          
SEQRES 182 B 2549  LEU HIS ILE ASP PHE GLY ASP CYS PHE GLU VAL ALA MET          
SEQRES 183 B 2549  THR ARG GLU LYS PHE PRO GLU LYS ILE PRO PHE ARG LEU          
SEQRES 184 B 2549  THR ARG MET LEU THR ASN ALA MET GLU VAL THR GLY LEU          
SEQRES 185 B 2549  ASP GLY ASN TYR ARG ILE THR CYS HIS THR VAL MET GLU          
SEQRES 186 B 2549  VAL LEU ARG GLU HIS LYS ASP SER VAL MET ALA VAL LEU          
SEQRES 187 B 2549  GLU ALA PHE VAL TYR ASP PRO LEU LEU ASN TRP ARG LEU          
SEQRES 188 B 2549  MET ASP THR ASN THR LYS GLY ASN LYS ARG SER ARG THR          
SEQRES 189 B 2549  ARG THR ASP SER TYR SER ALA GLY GLN SER VAL GLU ILE          
SEQRES 190 B 2549  LEU ASP GLY VAL GLU LEU GLY GLU PRO ALA HIS LYS LYS          
SEQRES 191 B 2549  THR GLY THR THR VAL PRO GLU SER ILE HIS SER PHE ILE          
SEQRES 192 B 2549  GLY ASP GLY LEU VAL LYS PRO GLU ALA LEU ASN LYS LYS          
SEQRES 193 B 2549  ALA ILE GLN ILE ILE ASN ARG VAL ARG ASP LYS LEU THR          
SEQRES 194 B 2549  GLY ARG ASP PHE SER HIS ASP ASP THR LEU ASP VAL PRO          
SEQRES 195 B 2549  THR GLN VAL GLU LEU LEU ILE LYS GLN ALA THR SER HIS          
SEQRES 196 B 2549  GLU ASN LEU CYS GLN CYS TYR ILE GLY TRP CYS PRO PHE          
SEQRES 197 B 2549  TRP                                                          
SEQRES   1 C  326  MET ASN THR SER PRO GLY THR VAL GLY SER ASP PRO VAL          
SEQRES   2 C  326  ILE LEU ALA THR ALA GLY TYR ASP HIS THR VAL ARG PHE          
SEQRES   3 C  326  TRP GLN ALA HIS SER GLY ILE CYS THR ARG THR VAL GLN          
SEQRES   4 C  326  HIS GLN ASP SER GLN VAL ASN ALA LEU GLU VAL THR PRO          
SEQRES   5 C  326  ASP ARG SER MET ILE ALA ALA ALA GLY TYR GLN HIS ILE          
SEQRES   6 C  326  ARG MET TYR ASP LEU ASN SER ASN ASN PRO ASN PRO ILE          
SEQRES   7 C  326  ILE SER TYR ASP GLY VAL ASN LYS ASN ILE ALA SER VAL          
SEQRES   8 C  326  GLY PHE HIS GLU ASP GLY ARG TRP MET TYR THR GLY GLY          
SEQRES   9 C  326  GLU ASP CYS THR ALA ARG ILE TRP ASP LEU ARG SER ARG          
SEQRES  10 C  326  ASN LEU GLN CYS GLN ARG ILE PHE GLN VAL ASN ALA PRO          
SEQRES  11 C  326  ILE ASN CYS VAL CYS LEU HIS PRO ASN GLN ALA GLU LEU          
SEQRES  12 C  326  ILE VAL GLY ASP GLN SER GLY ALA ILE HIS ILE TRP ASP          
SEQRES  13 C  326  LEU LYS THR ASP HIS ASN GLU GLN LEU ILE PRO GLU PRO          
SEQRES  14 C  326  GLU VAL SER ILE THR SER ALA HIS ILE ASP PRO ASP ALA          
SEQRES  15 C  326  SER TYR MET ALA ALA VAL ASN SER THR GLY ASN CYS TYR          
SEQRES  16 C  326  VAL TRP ASN LEU THR GLY GLY ILE GLY ASP GLU VAL THR          
SEQRES  17 C  326  GLN LEU ILE PRO LYS THR LYS ILE PRO ALA HIS THR ARG          
SEQRES  18 C  326  TYR ALA LEU GLN CYS ARG PHE SER PRO ASP SER THR LEU          
SEQRES  19 C  326  LEU ALA THR CYS SER ALA ASP GLN THR CYS LYS ILE TRP          
SEQRES  20 C  326  ARG THR SER ASN PHE SER LEU MET THR GLU LEU SER ILE          
SEQRES  21 C  326  LYS SER GLY ASN PRO GLY GLU SER SER ARG GLY TRP MET          
SEQRES  22 C  326  TRP GLY CYS ALA PHE SER GLY ASP SER GLN TYR ILE VAL          
SEQRES  23 C  326  THR ALA SER SER ASP ASN LEU ALA ARG LEU TRP CYS VAL          
SEQRES  24 C  326  GLU THR GLY GLU ILE LYS ARG GLU TYR GLY GLY HIS GLN          
SEQRES  25 C  326  LYS ALA VAL VAL CYS LEU ALA PHE ASN ASP SER VAL LEU          
SEQRES  26 C  326  GLY                                                          
SEQRES   1 D  326  MET ASN THR SER PRO GLY THR VAL GLY SER ASP PRO VAL          
SEQRES   2 D  326  ILE LEU ALA THR ALA GLY TYR ASP HIS THR VAL ARG PHE          
SEQRES   3 D  326  TRP GLN ALA HIS SER GLY ILE CYS THR ARG THR VAL GLN          
SEQRES   4 D  326  HIS GLN ASP SER GLN VAL ASN ALA LEU GLU VAL THR PRO          
SEQRES   5 D  326  ASP ARG SER MET ILE ALA ALA ALA GLY TYR GLN HIS ILE          
SEQRES   6 D  326  ARG MET TYR ASP LEU ASN SER ASN ASN PRO ASN PRO ILE          
SEQRES   7 D  326  ILE SER TYR ASP GLY VAL ASN LYS ASN ILE ALA SER VAL          
SEQRES   8 D  326  GLY PHE HIS GLU ASP GLY ARG TRP MET TYR THR GLY GLY          
SEQRES   9 D  326  GLU ASP CYS THR ALA ARG ILE TRP ASP LEU ARG SER ARG          
SEQRES  10 D  326  ASN LEU GLN CYS GLN ARG ILE PHE GLN VAL ASN ALA PRO          
SEQRES  11 D  326  ILE ASN CYS VAL CYS LEU HIS PRO ASN GLN ALA GLU LEU          
SEQRES  12 D  326  ILE VAL GLY ASP GLN SER GLY ALA ILE HIS ILE TRP ASP          
SEQRES  13 D  326  LEU LYS THR ASP HIS ASN GLU GLN LEU ILE PRO GLU PRO          
SEQRES  14 D  326  GLU VAL SER ILE THR SER ALA HIS ILE ASP PRO ASP ALA          
SEQRES  15 D  326  SER TYR MET ALA ALA VAL ASN SER THR GLY ASN CYS TYR          
SEQRES  16 D  326  VAL TRP ASN LEU THR GLY GLY ILE GLY ASP GLU VAL THR          
SEQRES  17 D  326  GLN LEU ILE PRO LYS THR LYS ILE PRO ALA HIS THR ARG          
SEQRES  18 D  326  TYR ALA LEU GLN CYS ARG PHE SER PRO ASP SER THR LEU          
SEQRES  19 D  326  LEU ALA THR CYS SER ALA ASP GLN THR CYS LYS ILE TRP          
SEQRES  20 D  326  ARG THR SER ASN PHE SER LEU MET THR GLU LEU SER ILE          
SEQRES  21 D  326  LYS SER GLY ASN PRO GLY GLU SER SER ARG GLY TRP MET          
SEQRES  22 D  326  TRP GLY CYS ALA PHE SER GLY ASP SER GLN TYR ILE VAL          
SEQRES  23 D  326  THR ALA SER SER ASP ASN LEU ALA ARG LEU TRP CYS VAL          
SEQRES  24 D  326  GLU THR GLY GLU ILE LYS ARG GLU TYR GLY GLY HIS GLN          
SEQRES  25 D  326  LYS ALA VAL VAL CYS LEU ALA PHE ASN ASP SER VAL LEU          
SEQRES  26 D  326  GLY                                                          
SEQRES   1 E 1708  MET ALA ALA ILE GLY ARG GLY ARG SER LEU LYS ASN LEU          
SEQRES   2 E 1708  ARG VAL ARG GLY ARG ASN ASP SER GLY GLU GLU ASN VAL          
SEQRES   3 E 1708  PRO LEU ASP LEU THR ARG GLU PRO SER ASP ASN LEU ARG          
SEQRES   4 E 1708  GLU ILE LEU GLN ASN VAL ALA ARG LEU GLN GLY VAL SER          
SEQRES   5 E 1708  ASN MET ARG LYS LEU GLY HIS LEU ASN ASN PHE THR LYS          
SEQRES   6 E 1708  LEU LEU CYS ASP ILE GLY HIS SER GLU GLU LYS LEU GLY          
SEQRES   7 E 1708  PHE HIS TYR GLU ASP ILE ILE ILE CYS LEU ARG LEU ALA          
SEQRES   8 E 1708  LEU LEU ASN GLU ALA LYS GLU VAL ARG ALA ALA GLY LEU          
SEQRES   9 E 1708  ARG ALA LEU ARG TYR LEU ILE GLN ASP SER SER ILE LEU          
SEQRES  10 E 1708  GLN LYS VAL LEU LYS LEU LYS VAL ASP TYR LEU ILE ALA          
SEQRES  11 E 1708  ARG CYS ILE ASP ILE GLN GLN SER ASN GLU VAL GLU ARG          
SEQRES  12 E 1708  THR GLN ALA LEU ARG LEU VAL ARG LYS MET ILE THR VAL          
SEQRES  13 E 1708  ASN ALA SER LEU PHE PRO SER SER VAL THR ASN SER LEU          
SEQRES  14 E 1708  ILE ALA VAL GLY ASN ASP GLY LEU GLN GLU ARG ASP ARG          
SEQRES  15 E 1708  MET VAL ARG ALA CYS ILE ALA ILE ILE CYS GLU LEU ALA          
SEQRES  16 E 1708  LEU GLN ASN PRO GLU VAL VAL ALA LEU ARG GLY GLY LEU          
SEQRES  17 E 1708  ASN THR ILE LEU LYS ASN VAL ILE ASP CYS GLN LEU SER          
SEQRES  18 E 1708  ARG ILE ASN GLU ALA LEU ILE THR THR ILE LEU HIS LEU          
SEQRES  19 E 1708  LEU ASN HIS PRO LYS THR ARG GLN TYR VAL ARG ALA ASP          
SEQRES  20 E 1708  VAL GLU LEU GLU ARG ILE LEU ALA PRO TYR THR ASP PHE          
SEQRES  21 E 1708  HIS TYR ARG HIS SER PRO ASP THR ALA GLU GLY GLN LEU          
SEQRES  22 E 1708  LYS GLU ASP ARG GLU ALA ARG PHE LEU ALA SER LYS MET          
SEQRES  23 E 1708  GLY ILE ILE ALA THR PHE ARG SER TRP ALA GLY ILE ILE          
SEQRES  24 E 1708  ASN LEU CYS LYS PRO GLY ASN SER GLY ILE GLN SER LEU          
SEQRES  25 E 1708  ILE GLY VAL LEU CYS ILE PRO ASN MET GLU ILE ARG ARG          
SEQRES  26 E 1708  GLY LEU LEU GLU VAL LEU TYR ASP ILE PHE ARG LEU PRO          
SEQRES  27 E 1708  LEU PRO VAL VAL THR GLU GLU PHE ILE GLU ALA LEU LEU          
SEQRES  28 E 1708  SER VAL ASP PRO GLY ARG PHE GLN ASP SER TRP ARG LEU          
SEQRES  29 E 1708  SER ASP GLY PHE VAL ALA ALA GLU ALA LYS THR ILE LEU          
SEQRES  30 E 1708  PRO HIS ARG ALA ARG SER ARG PRO ASP LEU MET ASP ASN          
SEQRES  31 E 1708  TYR LEU ALA LEU ILE LEU SER ALA PHE ILE ARG ASN GLY          
SEQRES  32 E 1708  LEU LEU GLU GLY LEU VAL GLU VAL ILE THR ASN SER ASP          
SEQRES  33 E 1708  ASP HIS ILE SER VAL ARG ALA THR ILE LEU LEU GLY GLU          
SEQRES  34 E 1708  LEU LEU HIS MET ALA ASN THR ILE LEU PRO HIS SER HIS          
SEQRES  35 E 1708  SER HIS HIS LEU HIS CYS LEU PRO THR LEU MET ASN MET          
SEQRES  36 E 1708  ALA ALA SER PHE ASP ILE PRO LYS GLU LYS ARG LEU ARG          
SEQRES  37 E 1708  ALA SER ALA ALA LEU ASN CYS LEU LYS ARG PHE HIS GLU          
SEQRES  38 E 1708  MET LYS LYS ARG GLY PRO LYS PRO TYR SER LEU HIS LEU          
SEQRES  39 E 1708  ASP HIS ILE ILE GLN LYS ALA ILE ALA THR HIS GLN LYS          
SEQRES  40 E 1708  ARG ASP GLN TYR LEU ARG VAL GLN LYS ASP ILE PHE ILE          
SEQRES  41 E 1708  LEU LYS ASP THR GLU GLU ALA LEU LEU ILE ASN LEU ARG          
SEQRES  42 E 1708  ASP SER GLN VAL LEU GLN HIS LYS GLU ASN LEU GLU TRP          
SEQRES  43 E 1708  ASN TRP ASN LEU ILE GLY THR ILE LEU LYS TRP PRO ASN          
SEQRES  44 E 1708  VAL ASN LEU ARG ASN TYR LYS ASP GLU GLN LEU HIS ARG          
SEQRES  45 E 1708  PHE VAL ARG ARG LEU LEU TYR PHE TYR LYS PRO SER SER          
SEQRES  46 E 1708  LYS LEU TYR ALA ASN LEU ASP LEU ASP PHE ALA LYS ALA          
SEQRES  47 E 1708  LYS GLN LEU THR VAL VAL GLY CYS GLN PHE THR GLU PHE          
SEQRES  48 E 1708  LEU LEU GLU SER GLU GLU ASP GLY GLN GLY TYR LEU GLU          
SEQRES  49 E 1708  ASP LEU VAL LYS ASP ILE VAL GLN TRP LEU ASN ALA SER          
SEQRES  50 E 1708  SER GLY MET LYS PRO GLU ARG SER LEU GLN ASN ASN GLY          
SEQRES  51 E 1708  LEU LEU THR THR LEU SER GLN HIS TYR PHE LEU PHE ILE          
SEQRES  52 E 1708  GLY THR LEU SER CYS HIS PRO HIS GLY VAL LYS MET LEU          
SEQRES  53 E 1708  GLU LYS CYS SER VAL PHE GLN CYS LEU LEU ASN LEU CYS          
SEQRES  54 E 1708  SER LEU LYS ASN GLN ASP HIS LEU LEU LYS LEU THR VAL          
SEQRES  55 E 1708  SER SER LEU ASP TYR SER ARG ASP GLY LEU ALA ARG VAL          
SEQRES  56 E 1708  ILE LEU SER LYS ILE LEU THR ALA ALA THR ASP ALA CYS          
SEQRES  57 E 1708  ARG LEU TYR ALA THR LYS HIS LEU ARG VAL LEU LEU ARG          
SEQRES  58 E 1708  ALA ASN VAL GLU PHE PHE ASN ASN TRP GLY ILE GLU LEU          
SEQRES  59 E 1708  LEU VAL THR GLN LEU HIS ASP LYS ASN LYS THR ILE SER          
SEQRES  60 E 1708  SER GLU ALA LEU ASP ILE LEU ASP GLU ALA CYS GLU ASP          
SEQRES  61 E 1708  LYS ALA ASN LEU HIS ALA LEU ILE GLN MET LYS PRO ALA          
SEQRES  62 E 1708  LEU SER HIS LEU GLY ASP LYS GLY LEU LEU LEU LEU LEU          
SEQRES  63 E 1708  ARG PHE LEU SER ILE PRO LYS GLY PHE SER TYR LEU ASN          
SEQRES  64 E 1708  GLU ARG GLY TYR VAL ALA LYS GLN LEU GLU LYS TRP HIS          
SEQRES  65 E 1708  ARG GLU TYR ASN SER LYS TYR VAL ASP LEU ILE GLU GLU          
SEQRES  66 E 1708  GLN LEU ASN GLU ALA LEU THR THR TYR ARG LYS PRO VAL          
SEQRES  67 E 1708  ASP GLY ASP ASN TYR VAL ARG ARG SER ASN GLN ARG LEU          
SEQRES  68 E 1708  GLN ARG PRO HIS VAL TYR LEU PRO ILE HIS LEU TYR GLY          
SEQRES  69 E 1708  GLN LEU VAL HIS HIS LYS THR GLY CYS HIS LEU LEU GLU          
SEQRES  70 E 1708  VAL GLN ASN ILE ILE THR GLU LEU CYS ARG ASN VAL ARG          
SEQRES  71 E 1708  THR PRO ASP LEU ASP LYS TRP GLU GLU ILE LYS LYS LEU          
SEQRES  72 E 1708  LYS ALA SER LEU TRP ALA LEU GLY ASN ILE GLY SER SER          
SEQRES  73 E 1708  ASN TRP GLY LEU ASN LEU LEU GLN GLU GLU ASN VAL ILE          
SEQRES  74 E 1708  PRO ASP ILE LEU LYS LEU ALA LYS GLN CYS GLU VAL LEU          
SEQRES  75 E 1708  SER ILE ARG GLY THR CYS VAL TYR VAL LEU GLY LEU ILE          
SEQRES  76 E 1708  ALA LYS THR LYS GLN GLY CYS ASP ILE LEU LYS CYS HIS          
SEQRES  77 E 1708  ASN TRP ASP ALA VAL ARG HIS SER ARG LYS HIS LEU TRP          
SEQRES  78 E 1708  PRO VAL VAL PRO ASP ASP VAL GLU GLN LEU CYS ASN GLU          
SEQRES  79 E 1708  LEU SER SER ILE UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  80 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  81 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  82 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  83 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  84 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  85 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  86 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  87 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  88 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  89 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  90 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  91 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  92 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  93 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  94 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  95 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  96 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  97 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  98 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  99 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 100 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 101 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 102 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 103 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 104 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 105 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 106 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 107 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 108 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 109 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 110 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 111 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 112 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 113 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 114 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 115 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 116 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 117 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 118 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 119 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 120 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 121 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 122 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 123 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 124 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 125 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 126 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 127 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 128 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 129 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 130 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 131 E 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 132 E 1708  UNK UNK UNK UNK UNK                                          
SEQRES   1 F 1708  MET ALA ALA ILE GLY ARG GLY ARG SER LEU LYS ASN LEU          
SEQRES   2 F 1708  ARG VAL ARG GLY ARG ASN ASP SER GLY GLU GLU ASN VAL          
SEQRES   3 F 1708  PRO LEU ASP LEU THR ARG GLU PRO SER ASP ASN LEU ARG          
SEQRES   4 F 1708  GLU ILE LEU GLN ASN VAL ALA ARG LEU GLN GLY VAL SER          
SEQRES   5 F 1708  ASN MET ARG LYS LEU GLY HIS LEU ASN ASN PHE THR LYS          
SEQRES   6 F 1708  LEU LEU CYS ASP ILE GLY HIS SER GLU GLU LYS LEU GLY          
SEQRES   7 F 1708  PHE HIS TYR GLU ASP ILE ILE ILE CYS LEU ARG LEU ALA          
SEQRES   8 F 1708  LEU LEU ASN GLU ALA LYS GLU VAL ARG ALA ALA GLY LEU          
SEQRES   9 F 1708  ARG ALA LEU ARG TYR LEU ILE GLN ASP SER SER ILE LEU          
SEQRES  10 F 1708  GLN LYS VAL LEU LYS LEU LYS VAL ASP TYR LEU ILE ALA          
SEQRES  11 F 1708  ARG CYS ILE ASP ILE GLN GLN SER ASN GLU VAL GLU ARG          
SEQRES  12 F 1708  THR GLN ALA LEU ARG LEU VAL ARG LYS MET ILE THR VAL          
SEQRES  13 F 1708  ASN ALA SER LEU PHE PRO SER SER VAL THR ASN SER LEU          
SEQRES  14 F 1708  ILE ALA VAL GLY ASN ASP GLY LEU GLN GLU ARG ASP ARG          
SEQRES  15 F 1708  MET VAL ARG ALA CYS ILE ALA ILE ILE CYS GLU LEU ALA          
SEQRES  16 F 1708  LEU GLN ASN PRO GLU VAL VAL ALA LEU ARG GLY GLY LEU          
SEQRES  17 F 1708  ASN THR ILE LEU LYS ASN VAL ILE ASP CYS GLN LEU SER          
SEQRES  18 F 1708  ARG ILE ASN GLU ALA LEU ILE THR THR ILE LEU HIS LEU          
SEQRES  19 F 1708  LEU ASN HIS PRO LYS THR ARG GLN TYR VAL ARG ALA ASP          
SEQRES  20 F 1708  VAL GLU LEU GLU ARG ILE LEU ALA PRO TYR THR ASP PHE          
SEQRES  21 F 1708  HIS TYR ARG HIS SER PRO ASP THR ALA GLU GLY GLN LEU          
SEQRES  22 F 1708  LYS GLU ASP ARG GLU ALA ARG PHE LEU ALA SER LYS MET          
SEQRES  23 F 1708  GLY ILE ILE ALA THR PHE ARG SER TRP ALA GLY ILE ILE          
SEQRES  24 F 1708  ASN LEU CYS LYS PRO GLY ASN SER GLY ILE GLN SER LEU          
SEQRES  25 F 1708  ILE GLY VAL LEU CYS ILE PRO ASN MET GLU ILE ARG ARG          
SEQRES  26 F 1708  GLY LEU LEU GLU VAL LEU TYR ASP ILE PHE ARG LEU PRO          
SEQRES  27 F 1708  LEU PRO VAL VAL THR GLU GLU PHE ILE GLU ALA LEU LEU          
SEQRES  28 F 1708  SER VAL ASP PRO GLY ARG PHE GLN ASP SER TRP ARG LEU          
SEQRES  29 F 1708  SER ASP GLY PHE VAL ALA ALA GLU ALA LYS THR ILE LEU          
SEQRES  30 F 1708  PRO HIS ARG ALA ARG SER ARG PRO ASP LEU MET ASP ASN          
SEQRES  31 F 1708  TYR LEU ALA LEU ILE LEU SER ALA PHE ILE ARG ASN GLY          
SEQRES  32 F 1708  LEU LEU GLU GLY LEU VAL GLU VAL ILE THR ASN SER ASP          
SEQRES  33 F 1708  ASP HIS ILE SER VAL ARG ALA THR ILE LEU LEU GLY GLU          
SEQRES  34 F 1708  LEU LEU HIS MET ALA ASN THR ILE LEU PRO HIS SER HIS          
SEQRES  35 F 1708  SER HIS HIS LEU HIS CYS LEU PRO THR LEU MET ASN MET          
SEQRES  36 F 1708  ALA ALA SER PHE ASP ILE PRO LYS GLU LYS ARG LEU ARG          
SEQRES  37 F 1708  ALA SER ALA ALA LEU ASN CYS LEU LYS ARG PHE HIS GLU          
SEQRES  38 F 1708  MET LYS LYS ARG GLY PRO LYS PRO TYR SER LEU HIS LEU          
SEQRES  39 F 1708  ASP HIS ILE ILE GLN LYS ALA ILE ALA THR HIS GLN LYS          
SEQRES  40 F 1708  ARG ASP GLN TYR LEU ARG VAL GLN LYS ASP ILE PHE ILE          
SEQRES  41 F 1708  LEU LYS ASP THR GLU GLU ALA LEU LEU ILE ASN LEU ARG          
SEQRES  42 F 1708  ASP SER GLN VAL LEU GLN HIS LYS GLU ASN LEU GLU TRP          
SEQRES  43 F 1708  ASN TRP ASN LEU ILE GLY THR ILE LEU LYS TRP PRO ASN          
SEQRES  44 F 1708  VAL ASN LEU ARG ASN TYR LYS ASP GLU GLN LEU HIS ARG          
SEQRES  45 F 1708  PHE VAL ARG ARG LEU LEU TYR PHE TYR LYS PRO SER SER          
SEQRES  46 F 1708  LYS LEU TYR ALA ASN LEU ASP LEU ASP PHE ALA LYS ALA          
SEQRES  47 F 1708  LYS GLN LEU THR VAL VAL GLY CYS GLN PHE THR GLU PHE          
SEQRES  48 F 1708  LEU LEU GLU SER GLU GLU ASP GLY GLN GLY TYR LEU GLU          
SEQRES  49 F 1708  ASP LEU VAL LYS ASP ILE VAL GLN TRP LEU ASN ALA SER          
SEQRES  50 F 1708  SER GLY MET LYS PRO GLU ARG SER LEU GLN ASN ASN GLY          
SEQRES  51 F 1708  LEU LEU THR THR LEU SER GLN HIS TYR PHE LEU PHE ILE          
SEQRES  52 F 1708  GLY THR LEU SER CYS HIS PRO HIS GLY VAL LYS MET LEU          
SEQRES  53 F 1708  GLU LYS CYS SER VAL PHE GLN CYS LEU LEU ASN LEU CYS          
SEQRES  54 F 1708  SER LEU LYS ASN GLN ASP HIS LEU LEU LYS LEU THR VAL          
SEQRES  55 F 1708  SER SER LEU ASP TYR SER ARG ASP GLY LEU ALA ARG VAL          
SEQRES  56 F 1708  ILE LEU SER LYS ILE LEU THR ALA ALA THR ASP ALA CYS          
SEQRES  57 F 1708  ARG LEU TYR ALA THR LYS HIS LEU ARG VAL LEU LEU ARG          
SEQRES  58 F 1708  ALA ASN VAL GLU PHE PHE ASN ASN TRP GLY ILE GLU LEU          
SEQRES  59 F 1708  LEU VAL THR GLN LEU HIS ASP LYS ASN LYS THR ILE SER          
SEQRES  60 F 1708  SER GLU ALA LEU ASP ILE LEU ASP GLU ALA CYS GLU ASP          
SEQRES  61 F 1708  LYS ALA ASN LEU HIS ALA LEU ILE GLN MET LYS PRO ALA          
SEQRES  62 F 1708  LEU SER HIS LEU GLY ASP LYS GLY LEU LEU LEU LEU LEU          
SEQRES  63 F 1708  ARG PHE LEU SER ILE PRO LYS GLY PHE SER TYR LEU ASN          
SEQRES  64 F 1708  GLU ARG GLY TYR VAL ALA LYS GLN LEU GLU LYS TRP HIS          
SEQRES  65 F 1708  ARG GLU TYR ASN SER LYS TYR VAL ASP LEU ILE GLU GLU          
SEQRES  66 F 1708  GLN LEU ASN GLU ALA LEU THR THR TYR ARG LYS PRO VAL          
SEQRES  67 F 1708  ASP GLY ASP ASN TYR VAL ARG ARG SER ASN GLN ARG LEU          
SEQRES  68 F 1708  GLN ARG PRO HIS VAL TYR LEU PRO ILE HIS LEU TYR GLY          
SEQRES  69 F 1708  GLN LEU VAL HIS HIS LYS THR GLY CYS HIS LEU LEU GLU          
SEQRES  70 F 1708  VAL GLN ASN ILE ILE THR GLU LEU CYS ARG ASN VAL ARG          
SEQRES  71 F 1708  THR PRO ASP LEU ASP LYS TRP GLU GLU ILE LYS LYS LEU          
SEQRES  72 F 1708  LYS ALA SER LEU TRP ALA LEU GLY ASN ILE GLY SER SER          
SEQRES  73 F 1708  ASN TRP GLY LEU ASN LEU LEU GLN GLU GLU ASN VAL ILE          
SEQRES  74 F 1708  PRO ASP ILE LEU LYS LEU ALA LYS GLN CYS GLU VAL LEU          
SEQRES  75 F 1708  SER ILE ARG GLY THR CYS VAL TYR VAL LEU GLY LEU ILE          
SEQRES  76 F 1708  ALA LYS THR LYS GLN GLY CYS ASP ILE LEU LYS CYS HIS          
SEQRES  77 F 1708  ASN TRP ASP ALA VAL ARG HIS SER ARG LYS HIS LEU TRP          
SEQRES  78 F 1708  PRO VAL VAL PRO ASP ASP VAL GLU GLN LEU CYS ASN GLU          
SEQRES  79 F 1708  LEU SER SER ILE UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  80 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  81 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  82 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  83 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  84 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  85 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  86 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  87 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  88 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  89 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  90 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  91 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  92 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  93 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  94 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  95 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  96 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  97 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  98 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  99 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 100 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 101 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 102 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 103 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 104 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 105 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 106 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 107 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 108 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 109 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 110 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 111 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 112 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 113 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 114 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 115 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 116 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 117 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 118 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 119 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 120 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 121 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 122 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 123 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 124 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 125 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 126 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 127 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 128 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 129 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 130 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 131 F 1708  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES 132 F 1708  UNK UNK UNK UNK UNK                                          
SEQRES   1 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 G  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK ILE LEU SER          
SEQRES  12 G  522  VAL ARG LEU GLU GLN CYS PRO LEU GLN LEU ASN ASN PRO          
SEQRES  13 G  522  PHE ASN GLU TYR SER LYS PHE ASP GLY LYS GLY HIS VAL          
SEQRES  14 G  522  GLY THR THR ALA THR LYS LYS ILE ASP VAL TYR LEU PRO          
SEQRES  15 G  522  LEU HIS SER SER GLN ASP ARG LEU LEU PRO MET THR VAL          
SEQRES  16 G  522  VAL THR MET ALA SER ALA ARG VAL GLN ASP LEU ILE GLY          
SEQRES  17 G  522  LEU ILE CYS TRP GLN TYR THR SER GLU GLY ARG GLU PRO          
SEQRES  18 G  522  LYS LEU ASN ASP ASN VAL SER ALA TYR CYS LEU HIS ILE          
SEQRES  19 G  522  ALA GLU ASP ASP GLY GLU VAL ASP THR ASP PHE PRO PRO          
SEQRES  20 G  522  LEU ASP SER ASN GLU PRO ILE HIS LYS PHE GLY PHE SER          
SEQRES  21 G  522  THR LEU ALA LEU VAL GLU LYS TYR SER SER PRO GLY LEU          
SEQRES  22 G  522  THR SER LYS GLU SER LEU PHE VAL ARG ILE ASN ALA ALA          
SEQRES  23 G  522  HIS GLY PHE SER LEU ILE GLN VAL ASP ASN THR LYS VAL          
SEQRES  24 G  522  THR MET LYS GLU ILE LEU LEU LYS ALA VAL LYS ARG ARG          
SEQRES  25 G  522  LYS GLY SER GLN LYS VAL SER GLY PRO GLN TYR ARG LEU          
SEQRES  26 G  522  GLU LYS GLN SER GLU PRO ASN VAL ALA VAL ASP LEU ASP          
SEQRES  27 G  522  SER THR LEU GLU SER GLN SER ALA TRP GLU PHE CYS LEU          
SEQRES  28 G  522  VAL ARG GLU ASN SER SER ARG ALA ASP GLY VAL PHE GLU          
SEQRES  29 G  522  GLU ASP SER GLN ILE ASP ILE ALA THR VAL GLN ASP MET          
SEQRES  30 G  522  LEU SER SER HIS HIS TYR LYS SER PHE LYS VAL SER MET          
SEQRES  31 G  522  ILE HIS ARG LEU ARG PHE THR THR ASP VAL GLN LEU GLY          
SEQRES  32 G  522  ILE SER GLY ASP LYS VAL GLU ILE ASP PRO VAL THR ASN          
SEQRES  33 G  522  GLN LYS ALA SER THR LYS PHE TRP ILE LYS GLN LYS PRO          
SEQRES  34 G  522  ILE SER ILE ASP SER ASP LEU LEU CYS ALA CYS ASP LEU          
SEQRES  35 G  522  ALA GLU GLU LYS SER PRO SER HIS ALA ILE PHE LYS LEU          
SEQRES  36 G  522  THR TYR LEU SER ASN HIS ASP TYR LYS HIS LEU TYR PHE          
SEQRES  37 G  522  GLU SER ASP ALA ALA THR VAL ASN GLU ILE VAL LEU LYS          
SEQRES  38 G  522  VAL ASN TYR ILE LEU GLU SER ARG ALA SER THR ALA ARG          
SEQRES  39 G  522  ALA ASP TYR PHE ALA GLN LYS GLN ARG LYS LEU ASN ARG          
SEQRES  40 G  522  ARG THR SER PHE SER PHE GLN LYS GLU LYS LYS SER GLY          
SEQRES  41 G  522  GLN GLN                                                      
SEQRES   1 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 H  522  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK ILE LEU SER          
SEQRES  12 H  522  VAL ARG LEU GLU GLN CYS PRO LEU GLN LEU ASN ASN PRO          
SEQRES  13 H  522  PHE ASN GLU TYR SER LYS PHE ASP GLY LYS GLY HIS VAL          
SEQRES  14 H  522  GLY THR THR ALA THR LYS LYS ILE ASP VAL TYR LEU PRO          
SEQRES  15 H  522  LEU HIS SER SER GLN ASP ARG LEU LEU PRO MET THR VAL          
SEQRES  16 H  522  VAL THR MET ALA SER ALA ARG VAL GLN ASP LEU ILE GLY          
SEQRES  17 H  522  LEU ILE CYS TRP GLN TYR THR SER GLU GLY ARG GLU PRO          
SEQRES  18 H  522  LYS LEU ASN ASP ASN VAL SER ALA TYR CYS LEU HIS ILE          
SEQRES  19 H  522  ALA GLU ASP ASP GLY GLU VAL ASP THR ASP PHE PRO PRO          
SEQRES  20 H  522  LEU ASP SER ASN GLU PRO ILE HIS LYS PHE GLY PHE SER          
SEQRES  21 H  522  THR LEU ALA LEU VAL GLU LYS TYR SER SER PRO GLY LEU          
SEQRES  22 H  522  THR SER LYS GLU SER LEU PHE VAL ARG ILE ASN ALA ALA          
SEQRES  23 H  522  HIS GLY PHE SER LEU ILE GLN VAL ASP ASN THR LYS VAL          
SEQRES  24 H  522  THR MET LYS GLU ILE LEU LEU LYS ALA VAL LYS ARG ARG          
SEQRES  25 H  522  LYS GLY SER GLN LYS VAL SER GLY PRO GLN TYR ARG LEU          
SEQRES  26 H  522  GLU LYS GLN SER GLU PRO ASN VAL ALA VAL ASP LEU ASP          
SEQRES  27 H  522  SER THR LEU GLU SER GLN SER ALA TRP GLU PHE CYS LEU          
SEQRES  28 H  522  VAL ARG GLU ASN SER SER ARG ALA ASP GLY VAL PHE GLU          
SEQRES  29 H  522  GLU ASP SER GLN ILE ASP ILE ALA THR VAL GLN ASP MET          
SEQRES  30 H  522  LEU SER SER HIS HIS TYR LYS SER PHE LYS VAL SER MET          
SEQRES  31 H  522  ILE HIS ARG LEU ARG PHE THR THR ASP VAL GLN LEU GLY          
SEQRES  32 H  522  ILE SER GLY ASP LYS VAL GLU ILE ASP PRO VAL THR ASN          
SEQRES  33 H  522  GLN LYS ALA SER THR LYS PHE TRP ILE LYS GLN LYS PRO          
SEQRES  34 H  522  ILE SER ILE ASP SER ASP LEU LEU CYS ALA CYS ASP LEU          
SEQRES  35 H  522  ALA GLU GLU LYS SER PRO SER HIS ALA ILE PHE LYS LEU          
SEQRES  36 H  522  THR TYR LEU SER ASN HIS ASP TYR LYS HIS LEU TYR PHE          
SEQRES  37 H  522  GLU SER ASP ALA ALA THR VAL ASN GLU ILE VAL LEU LYS          
SEQRES  38 H  522  VAL ASN TYR ILE LEU GLU SER ARG ALA SER THR ALA ARG          
SEQRES  39 H  522  ALA ASP TYR PHE ALA GLN LYS GLN ARG LYS LEU ASN ARG          
SEQRES  40 H  522  ARG THR SER PHE SER PHE GLN LYS GLU LYS LYS SER GLY          
SEQRES  41 H  522  GLN GLN                                                      
HELIX    1 AA1 PHE A   25  LYS A   30  1                                   6    
HELIX    2 AA2 PHE A   63  LEU A   74  1                                  12    
HELIX    3 AA3 GLY A   85  ILE A   94  1                                  10    
HELIX    4 AA4 ALA A  101  ALA A  108  1                                   8    
HELIX    5 AA5 ASN A  109  LEU A  111  5                                   3    
HELIX    6 AA6 VAL A  121  ARG A  132  1                                  12    
HELIX    7 AA7 PHE A  140  ARG A  151  1                                  12    
HELIX    8 AA8 ARG A  165  LEU A  172  1                                   8    
HELIX    9 AA9 PRO A  180  PHE A  184  5                                   5    
HELIX   10 AB1 PRO A  189  TRP A  199  1                                  11    
HELIX   11 AB2 ALA A  209  ALA A  215  1                                   7    
HELIX   12 AB3 LEU A  217  ARG A  223  1                                   7    
HELIX   13 AB4 TYR A  234  ASP A  246  1                                  13    
HELIX   14 AB5 LEU A  266  ILE A  274  1                                   9    
HELIX   15 AB6 SER A  276  GLU A  285  1                                  10    
HELIX   16 AB7 VAL A  357  CYS A  361  1                                   5    
HELIX   17 AB8 CYS A  362  GLN A  375  1                                  14    
HELIX   18 AB9 ILE A  388  LEU A  393  1                                   6    
HELIX   19 AC1 LEU A  395  ARG A  403  1                                   9    
HELIX   20 AC2 TYR A  412  LEU A  421  1                                  10    
HELIX   21 AC3 ARG A  430  GLY A  438  1                                   9    
HELIX   22 AC4 GLU A  447  ILE A  458  5                                  12    
HELIX   23 AC5 THR A  481  MET A  488  1                                   8    
HELIX   24 AC6 GLN A  498  LEU A  504  1                                   7    
HELIX   25 AC7 LEU A  504  LEU A  509  1                                   6    
HELIX   26 AC8 LEU A  517  ARG A  526  1                                  10    
HELIX   27 AC9 LEU A  531  LEU A  543  1                                  13    
HELIX   28 AD1 LEU A  543  MET A  548  1                                   6    
HELIX   29 AD2 VAL A  579  GLY A  590  1                                  12    
HELIX   30 AD3 VAL A  603  ALA A  607  5                                   5    
HELIX   31 AD4 GLU A  621  LEU A  630  1                                  10    
HELIX   32 AD5 ALA A  648  ILE A  664  1                                  17    
HELIX   33 AD6 ASP A  668  VAL A  675  1                                   8    
HELIX   34 AD7 ASP A  680  ASP A  684  5                                   5    
HELIX   35 AD8 GLN A  689  VAL A  698  1                                  10    
HELIX   36 AD9 LEU A  710  LEU A  718  1                                   9    
HELIX   37 AE1 PRO A  728  MET A  733  1                                   6    
HELIX   38 AE2 ILE A  746  LEU A  757  1                                  12    
HELIX   39 AE3 ALA A  764  ILE A  768  5                                   5    
HELIX   40 AE4 TYR A  771  ALA A  778  1                                   8    
HELIX   41 AE5 LEU A  779  LYS A  784  5                                   6    
HELIX   42 AE6 PRO A  792  GLY A  803  1                                  12    
HELIX   43 AE7 MET A  813  VAL A  817  5                                   5    
HELIX   44 AE8 ILE A  824  GLN A  829  1                                   6    
HELIX   45 AE9 LYS A  836  LEU A  847  1                                  12    
HELIX   46 AF1 LEU A  847  GLY A  852  1                                   6    
HELIX   47 AF2 GLU A  866  GLU A  875  1                                  10    
HELIX   48 AF3 ASN A  877  LEU A  891  1                                  15    
HELIX   49 AF4 ASP A  895  ILE A  903  1                                   9    
HELIX   50 AF5 VAL A  936  ASN A  940  5                                   5    
HELIX   51 AF6 PRO A  942  TYR A  947  1                                   6    
HELIX   52 AF7 HIS A  968  SER A  981  1                                  14    
HELIX   53 AF8 VAL A  993  LEU A  998  1                                   6    
HELIX   54 AF9 ASN A  999  CYS A 1004  1                                   6    
HELIX   55 AG1 PHE A 1011  VAL A 1020  1                                  10    
HELIX   56 AG2 ILE A 1027  TYR A 1030  5                                   4    
HELIX   57 AG3 MET A 1031  MET A 1038  1                                   8    
HELIX   58 AG4 ASN A 1045  ILE A 1053  1                                   9    
HELIX   59 AG5 ILE A 1059  GLY A 1064  1                                   6    
HELIX   60 AG6 GLU A 1066  TYR A 1070  5                                   5    
HELIX   61 AG7 LEU A 1071  GLN A 1073  5                                   3    
HELIX   62 AG8 LEU A 1074  ARG A 1080  1                                   7    
HELIX   63 AG9 ARG A 1090  GLN A 1101  1                                  12    
HELIX   64 AH1 VAL A 1119  ASP A 1123  5                                   5    
HELIX   65 AH2 GLU A 1137  GLU A 1144  1                                   8    
HELIX   66 AH3 ALA A 1152  ILE A 1156  5                                   5    
HELIX   67 AH4 HIS A 1157  SER A 1166  1                                  10    
HELIX   68 AH5 LEU A 1169  MET A 1174  1                                   6    
HELIX   69 AH6 ASP A 1175  GLY A 1185  1                                  11    
HELIX   70 AH7 TYR A 1188  ILE A 1190  5                                   3    
HELIX   71 AH8 PHE A 1191  ARG A 1203  1                                  13    
HELIX   72 AH9 ARG A 1208  GLY A 1219  1                                  12    
HELIX   73 AI1 THR A 1262  LYS A 1267  5                                   6    
HELIX   74 AI2 SER A 1276  ASP A 1294  1                                  19    
HELIX   75 AI3 SER A 1297  ARG A 1301  5                                   5    
HELIX   76 AI4 CYS A 1303  GLN A 1308  1                                   6    
HELIX   77 AI5 TYR A 1310  ASP A 1316  5                                   7    
HELIX   78 AI6 ASN A 1319  SER A 1327  1                                   9    
HELIX   79 AI7 GLN A 1333  LEU A 1343  1                                  11    
HELIX   80 AI8 ILE A 1350  LEU A 1360  1                                  11    
HELIX   81 AI9 PRO A 1373  ASP A 1377  5                                   5    
HELIX   82 AJ1 VAL A 1381  CYS A 1390  1                                  10    
HELIX   83 AJ2 TYR A 1399  GLN A 1405  1                                   7    
HELIX   84 AJ3 GLN A 1425  ALA A 1430  1                                   6    
HELIX   85 AJ4 ALA A 1447  LEU A 1453  1                                   7    
HELIX   86 AJ5 ALA A 1459  ASP A 1468  1                                  10    
HELIX   87 AJ6 ASP A 1473  MET A 1481  1                                   9    
HELIX   88 AJ7 MET A 1481  ALA A 1486  1                                   6    
HELIX   89 AJ8 GLU A 1489  CYS A 1498  1                                  10    
HELIX   90 AJ9 ASN A 1505  GLY A 1522  1                                  18    
HELIX   91 AK1 TRP A 1526  CYS A 1534  1                                   9    
HELIX   92 AK2 ALA A 1544  GLN A 1554  1                                  11    
HELIX   93 AK3 LEU A 1556  LYS A 1566  1                                  11    
HELIX   94 AK4 ALA A 1567  LEU A 1570  5                                   4    
HELIX   95 AK5 ASP A 1572  ALA A 1577  1                                   6    
HELIX   96 AK6 ALA A 1586  SER A 1597  1                                  12    
HELIX   97 AK7 ARG A 1611  TRP A 1619  1                                   9    
HELIX   98 AK8 ARG A 1622  CYS A 1626  5                                   5    
HELIX   99 AK9 ILE A 1629  LEU A 1637  5                                   9    
HELIX  100 AL1 MET A 1638  LEU A 1642  5                                   5    
HELIX  101 AL2 SER A 1645  ASP A 1649  5                                   5    
HELIX  102 AL3 THR A 1652  LYS A 1662  1                                  11    
HELIX  103 AL4 ARG A 1665  GLY A 1678  1                                  14    
HELIX  104 AL5 HIS A 1693  SER A 1707  1                                  15    
HELIX  105 AL6 ASP A 1712  GLN A 1725  1                                  14    
HELIX  106 AL7 GLN A 1726  ALA A 1731  1                                   6    
HELIX  107 AL8 ASP A 1736  PHE A 1751  1                                  16    
HELIX  108 AL9 LEU A 1752  GLY A 1755  5                                   4    
HELIX  109 AM1 TRP A 1757  GLN A 1762  1                                   6    
HELIX  110 AM2 THR A 1768  GLU A 1781  1                                  14    
HELIX  111 AM3 TRP A 1786  TRP A 1790  5                                   5    
HELIX  112 AM4 HIS A 1791  ASP A 1812  1                                  22    
HELIX  113 AM5 VAL A 1869  LEU A 1878  1                                  10    
HELIX  114 AM6 VAL A 1885  SER A 1893  1                                   9    
HELIX  115 AM7 ASN A 1898  THR A 1903  1                                   6    
HELIX  116 AM8 LEU A 1904  GLY A 1914  1                                  11    
HELIX  117 AM9 TRP A 1916  LEU A 1923  1                                   8    
HELIX  118 AN1 LEU A 1923  LYS A 1928  1                                   6    
HELIX  119 AN2 LEU A 1956  GLY A 1965  1                                  10    
HELIX  120 AN3 HIS A 1968  ALA A 1971  5                                   4    
HELIX  121 AN4 LEU A 1972  THR A 1977  1                                   6    
HELIX  122 AN5 THR A 1984  MET A 1998  1                                  15    
HELIX  123 AN6 CYS A 1999  HIS A 2001  5                                   3    
HELIX  124 AN7 LEU A 2005  ILE A 2021  1                                  17    
HELIX  125 AN8 LEU A 2022  GLU A 2041  1                                  20    
HELIX  126 AN9 LYS A 2045  ALA A 2056  1                                  12    
HELIX  127 AO1 THR A 2064  TYR A 2074  1                                  11    
HELIX  128 AO2 ASP A 2077  LYS A 2087  1                                  11    
HELIX  129 AO3 LEU A 2097  LYS A 2113  1                                  17    
HELIX  130 AO4 GLU A 2122  SER A 2127  1                                   6    
HELIX  131 AO5 PRO A 2128  LEU A 2131  5                                   4    
HELIX  132 AO6 GLN A 2200  LEU A 2209  1                                  10    
HELIX  133 AO7 ASP A 2212  ARG A 2217  1                                   6    
HELIX  134 AO8 LEU A 2246  ARG A 2254  1                                   9    
HELIX  135 AO9 HIS A 2265  ALA A 2272  1                                   8    
HELIX  136 AP1 PHE A 2287  VAL A 2291  5                                   5    
HELIX  137 AP2 ASP A 2298  LEU A 2303  1                                   6    
HELIX  138 AP3 SER A 2310  SER A 2323  1                                  14    
HELIX  139 AP4 MET A 2329  GLY A 2335  1                                   7    
HELIX  140 AP5 HIS A 2340  SER A 2342  5                                   3    
HELIX  141 AP6 THR A 2380  ALA A 2386  1                                   7    
HELIX  142 AP7 TYR A 2396  GLU A 2409  1                                  14    
HELIX  143 AP8 HIS A 2410  MET A 2415  1                                   6    
HELIX  144 AP9 VAL A 2417  VAL A 2422  1                                   6    
HELIX  145 AQ1 LEU A 2427  LEU A 2431  5                                   5    
HELIX  146 AQ2 LEU A 2493  GLY A 2510  1                                  18    
HELIX  147 AQ3 ASP A 2520  LEU A 2528  1                                   9    
HELIX  148 AQ4 ILE A 2529  SER A 2534  1                                   6    
HELIX  149 AQ5 PHE B   25  LYS B   30  1                                   6    
HELIX  150 AQ6 PHE B   63  LEU B   74  1                                  12    
HELIX  151 AQ7 GLY B   85  ILE B   94  1                                  10    
HELIX  152 AQ8 ALA B  101  ALA B  108  1                                   8    
HELIX  153 AQ9 ASN B  109  LEU B  111  5                                   3    
HELIX  154 AR1 VAL B  121  ARG B  132  1                                  12    
HELIX  155 AR2 PHE B  140  ARG B  151  1                                  12    
HELIX  156 AR3 ARG B  165  LEU B  172  1                                   8    
HELIX  157 AR4 PRO B  180  PHE B  184  5                                   5    
HELIX  158 AR5 PRO B  189  TRP B  199  1                                  11    
HELIX  159 AR6 ALA B  209  ALA B  215  1                                   7    
HELIX  160 AR7 LEU B  217  ARG B  223  1                                   7    
HELIX  161 AR8 TYR B  234  ASP B  246  1                                  13    
HELIX  162 AR9 LEU B  266  ILE B  274  1                                   9    
HELIX  163 AS1 SER B  276  GLU B  285  1                                  10    
HELIX  164 AS2 VAL B  357  CYS B  361  1                                   5    
HELIX  165 AS3 CYS B  362  GLN B  375  1                                  14    
HELIX  166 AS4 ILE B  388  LEU B  393  1                                   6    
HELIX  167 AS5 LEU B  395  ARG B  403  1                                   9    
HELIX  168 AS6 TYR B  412  LEU B  421  1                                  10    
HELIX  169 AS7 ARG B  430  GLY B  438  1                                   9    
HELIX  170 AS8 GLU B  447  ILE B  458  5                                  12    
HELIX  171 AS9 THR B  481  MET B  488  1                                   8    
HELIX  172 AT1 GLN B  498  LEU B  504  1                                   7    
HELIX  173 AT2 LEU B  504  LEU B  509  1                                   6    
HELIX  174 AT3 LEU B  517  ARG B  526  1                                  10    
HELIX  175 AT4 LEU B  531  LEU B  543  1                                  13    
HELIX  176 AT5 LEU B  543  MET B  548  1                                   6    
HELIX  177 AT6 VAL B  579  GLY B  590  1                                  12    
HELIX  178 AT7 VAL B  603  ALA B  607  5                                   5    
HELIX  179 AT8 GLU B  621  LEU B  630  1                                  10    
HELIX  180 AT9 ALA B  648  ILE B  664  1                                  17    
HELIX  181 AU1 ASP B  668  VAL B  675  1                                   8    
HELIX  182 AU2 ASP B  680  ASP B  684  5                                   5    
HELIX  183 AU3 GLN B  689  VAL B  698  1                                  10    
HELIX  184 AU4 LEU B  710  LEU B  718  1                                   9    
HELIX  185 AU5 PRO B  728  MET B  733  1                                   6    
HELIX  186 AU6 ILE B  746  LEU B  757  1                                  12    
HELIX  187 AU7 ALA B  764  ILE B  768  5                                   5    
HELIX  188 AU8 TYR B  771  ALA B  778  1                                   8    
HELIX  189 AU9 LEU B  779  LYS B  784  5                                   6    
HELIX  190 AV1 PRO B  792  GLY B  803  1                                  12    
HELIX  191 AV2 MET B  813  VAL B  817  5                                   5    
HELIX  192 AV3 ILE B  824  GLN B  829  1                                   6    
HELIX  193 AV4 LYS B  836  LEU B  847  1                                  12    
HELIX  194 AV5 LEU B  847  GLY B  852  1                                   6    
HELIX  195 AV6 GLU B  866  GLU B  875  1                                  10    
HELIX  196 AV7 ASN B  877  LEU B  891  1                                  15    
HELIX  197 AV8 ASP B  895  ILE B  903  1                                   9    
HELIX  198 AV9 VAL B  936  ASN B  940  5                                   5    
HELIX  199 AW1 PRO B  942  TYR B  947  1                                   6    
HELIX  200 AW2 HIS B  968  SER B  981  1                                  14    
HELIX  201 AW3 VAL B  993  LEU B  998  1                                   6    
HELIX  202 AW4 ASN B  999  CYS B 1004  1                                   6    
HELIX  203 AW5 PHE B 1011  VAL B 1020  1                                  10    
HELIX  204 AW6 ILE B 1027  TYR B 1030  5                                   4    
HELIX  205 AW7 MET B 1031  MET B 1038  1                                   8    
HELIX  206 AW8 ASN B 1045  ILE B 1053  1                                   9    
HELIX  207 AW9 ILE B 1059  GLY B 1064  1                                   6    
HELIX  208 AX1 GLU B 1066  TYR B 1070  5                                   5    
HELIX  209 AX2 LEU B 1071  GLN B 1073  5                                   3    
HELIX  210 AX3 LEU B 1074  ARG B 1080  1                                   7    
HELIX  211 AX4 ARG B 1090  GLN B 1101  1                                  12    
HELIX  212 AX5 VAL B 1119  ASP B 1123  5                                   5    
HELIX  213 AX6 GLU B 1137  GLU B 1144  1                                   8    
HELIX  214 AX7 ALA B 1152  ILE B 1156  5                                   5    
HELIX  215 AX8 HIS B 1157  SER B 1166  1                                  10    
HELIX  216 AX9 LEU B 1169  MET B 1174  1                                   6    
HELIX  217 AY1 ASP B 1175  GLY B 1185  1                                  11    
HELIX  218 AY2 TYR B 1188  ILE B 1190  5                                   3    
HELIX  219 AY3 PHE B 1191  ARG B 1203  1                                  13    
HELIX  220 AY4 ARG B 1208  GLY B 1219  1                                  12    
HELIX  221 AY5 THR B 1262  LYS B 1267  5                                   6    
HELIX  222 AY6 SER B 1276  ASP B 1294  1                                  19    
HELIX  223 AY7 SER B 1297  ARG B 1301  5                                   5    
HELIX  224 AY8 CYS B 1303  GLN B 1308  1                                   6    
HELIX  225 AY9 TYR B 1310  ASP B 1316  5                                   7    
HELIX  226 AZ1 ASN B 1319  SER B 1327  1                                   9    
HELIX  227 AZ2 GLN B 1333  LEU B 1343  1                                  11    
HELIX  228 AZ3 ILE B 1350  LEU B 1360  1                                  11    
HELIX  229 AZ4 PRO B 1373  ASP B 1377  5                                   5    
HELIX  230 AZ5 VAL B 1381  CYS B 1390  1                                  10    
HELIX  231 AZ6 TYR B 1399  GLN B 1405  1                                   7    
HELIX  232 AZ7 GLN B 1425  ALA B 1430  1                                   6    
HELIX  233 AZ8 ALA B 1447  LEU B 1453  1                                   7    
HELIX  234 AZ9 ALA B 1459  ASP B 1468  1                                  10    
HELIX  235 BA1 ASP B 1473  MET B 1481  1                                   9    
HELIX  236 BA2 MET B 1481  ALA B 1486  1                                   6    
HELIX  237 BA3 GLU B 1489  CYS B 1498  1                                  10    
HELIX  238 BA4 ASN B 1505  GLY B 1522  1                                  18    
HELIX  239 BA5 TRP B 1526  CYS B 1534  1                                   9    
HELIX  240 BA6 ALA B 1544  GLN B 1554  1                                  11    
HELIX  241 BA7 LEU B 1556  LYS B 1566  1                                  11    
HELIX  242 BA8 ALA B 1567  LEU B 1570  5                                   4    
HELIX  243 BA9 ASP B 1572  ALA B 1577  1                                   6    
HELIX  244 BB1 ALA B 1586  SER B 1597  1                                  12    
HELIX  245 BB2 ARG B 1611  TRP B 1619  1                                   9    
HELIX  246 BB3 ARG B 1622  CYS B 1626  5                                   5    
HELIX  247 BB4 ILE B 1629  LEU B 1637  5                                   9    
HELIX  248 BB5 MET B 1638  LEU B 1642  5                                   5    
HELIX  249 BB6 SER B 1645  ASP B 1649  5                                   5    
HELIX  250 BB7 THR B 1652  LYS B 1662  1                                  11    
HELIX  251 BB8 ARG B 1665  GLY B 1678  1                                  14    
HELIX  252 BB9 HIS B 1693  SER B 1707  1                                  15    
HELIX  253 BC1 ASP B 1712  GLN B 1725  1                                  14    
HELIX  254 BC2 GLN B 1726  ALA B 1731  1                                   6    
HELIX  255 BC3 ASP B 1736  PHE B 1751  1                                  16    
HELIX  256 BC4 LEU B 1752  GLY B 1755  5                                   4    
HELIX  257 BC5 TRP B 1757  GLN B 1762  1                                   6    
HELIX  258 BC6 THR B 1768  GLU B 1781  1                                  14    
HELIX  259 BC7 TRP B 1786  TRP B 1790  5                                   5    
HELIX  260 BC8 HIS B 1791  ASP B 1812  1                                  22    
HELIX  261 BC9 VAL B 1869  LEU B 1878  1                                  10    
HELIX  262 BD1 VAL B 1885  SER B 1893  1                                   9    
HELIX  263 BD2 ASN B 1898  THR B 1903  1                                   6    
HELIX  264 BD3 LEU B 1904  GLY B 1914  1                                  11    
HELIX  265 BD4 TRP B 1916  LEU B 1923  1                                   8    
HELIX  266 BD5 LEU B 1923  LYS B 1928  1                                   6    
HELIX  267 BD6 LEU B 1956  GLY B 1965  1                                  10    
HELIX  268 BD7 HIS B 1968  ALA B 1971  5                                   4    
HELIX  269 BD8 LEU B 1972  THR B 1977  1                                   6    
HELIX  270 BD9 THR B 1984  MET B 1998  1                                  15    
HELIX  271 BE1 CYS B 1999  HIS B 2001  5                                   3    
HELIX  272 BE2 LEU B 2005  ILE B 2021  1                                  17    
HELIX  273 BE3 LEU B 2022  GLU B 2041  1                                  20    
HELIX  274 BE4 LYS B 2045  ALA B 2056  1                                  12    
HELIX  275 BE5 THR B 2064  TYR B 2074  1                                  11    
HELIX  276 BE6 ASP B 2077  LYS B 2087  1                                  11    
HELIX  277 BE7 LEU B 2097  LYS B 2113  1                                  17    
HELIX  278 BE8 GLU B 2122  SER B 2127  1                                   6    
HELIX  279 BE9 PRO B 2128  LEU B 2131  5                                   4    
HELIX  280 BF1 GLN B 2200  LEU B 2209  1                                  10    
HELIX  281 BF2 ASP B 2212  ARG B 2217  1                                   6    
HELIX  282 BF3 LEU B 2246  ARG B 2254  1                                   9    
HELIX  283 BF4 HIS B 2265  ALA B 2272  1                                   8    
HELIX  284 BF5 PHE B 2287  VAL B 2291  5                                   5    
HELIX  285 BF6 ASP B 2298  LEU B 2303  1                                   6    
HELIX  286 BF7 SER B 2310  SER B 2323  1                                  14    
HELIX  287 BF8 MET B 2329  GLY B 2335  1                                   7    
HELIX  288 BF9 HIS B 2340  SER B 2342  5                                   3    
HELIX  289 BG1 THR B 2380  ALA B 2386  1                                   7    
HELIX  290 BG2 TYR B 2396  GLU B 2409  1                                  14    
HELIX  291 BG3 HIS B 2410  MET B 2415  1                                   6    
HELIX  292 BG4 VAL B 2417  VAL B 2422  1                                   6    
HELIX  293 BG5 LEU B 2427  LEU B 2431  5                                   5    
HELIX  294 BG6 LEU B 2493  GLY B 2510  1                                  18    
HELIX  295 BG7 ASP B 2520  LEU B 2528  1                                   9    
HELIX  296 BG8 ILE B 2529  SER B 2534  1                                   6    
HELIX  297 BG9 GLU E  193  ILE E  211  1                                  19    
HELIX  298 BH1 ILE E  216  LEU E  234  1                                  19    
HELIX  299 BH2 THR E  240  LEU E  250  1                                  11    
HELIX  300 BH3 TYR E  257  THR E  268  1                                  12    
HELIX  301 BH4 LEU E  273  GLU E  278  1                                   6    
HELIX  302 BH5 LEU E  282  PHE E  292  1                                  11    
HELIX  303 BH6 PHE E  292  GLY E  297  1                                   6    
HELIX  304 BH7 ILE E  298  LEU E  316  1                                  19    
HELIX  305 BH8 ASN E  320  LEU E  327  1                                   8    
HELIX  306 BH9 LEU E  327  LEU E  337  1                                  11    
HELIX  307 BI1 THR E  343  ASP E  354  1                                  12    
HELIX  308 BI2 SER E  365  LYS E  374  1                                  10    
HELIX  309 BI3 PRO E  378  PHE E  399  1                                  22    
HELIX  310 BI4 LEU E  405  VAL E  409  5                                   5    
HELIX  311 BI5 GLU E  410  HIS E  418  1                                   9    
HELIX  312 BI6 SER E  420  THR E  424  5                                   5    
HELIX  313 BI7 LEU E  430  CYS E  448  1                                  19    
HELIX  314 BI8 ALA E  456  ALA E  469  1                                  14    
HELIX  315 BI9 LEU E  473  LEU E  476  5                                   4    
HELIX  316 BJ1 LYS E  477  LYS E  483  1                                   7    
HELIX  317 BJ2 ILE E  498  LYS E  507  1                                  10    
HELIX  318 BJ3 ARG E  513  GLN E  536  1                                  24    
HELIX  319 BJ4 LYS E  541  ASN E  549  1                                   9    
HELIX  320 BJ5 ILE E  551  TRP E  557  1                                   7    
HELIX  321 BJ6 ASN E  564  LEU E  578  1                                  15    
HELIX  322 BJ7 TYR E  581  ASP E  592  1                                  12    
HELIX  323 BJ8 ASP E  594  THR E  609  1                                  16    
HELIX  324 BJ9 GLU E  610  LEU E  613  5                                   4    
HELIX  325 BK1 TYR E  622  GLN E  632  1                                  11    
HELIX  326 BK2 ALA E  636  MET E  640  5                                   5    
HELIX  327 BK3 LEU E  652  THR E  665  1                                  14    
HELIX  328 BK4 MET E  675  VAL E  681  1                                   7    
HELIX  329 BK5 ASN E  693  LEU E  705  1                                  13    
HELIX  330 BK6 TYR E  731  VAL E  744  1                                  14    
HELIX  331 BK7 GLY E  751  LYS E  764  1                                  14    
HELIX  332 BK8 LYS E  764  ASP E  772  1                                   9    
HELIX  333 BK9 GLY E  801  ILE E  811  1                                  11    
HELIX  334 BL1 SER E  816  VAL E  824  1                                   9    
HELIX  335 BL2 GLU E  829  ILE E  843  1                                  15    
HELIX  336 BL3 LEU E  847  ASP E  861  1                                  15    
HELIX  337 BL4 SER E  867  GLN E  872  5                                   6    
HELIX  338 BL5 ILE E  880  GLN E  885  1                                   6    
HELIX  339 BL6 LYS E  890  LEU E  896  1                                   7    
HELIX  340 BL7 LEU E  896  ARG E  907  1                                  12    
HELIX  341 BL8 THR E  911  LEU E  930  1                                  20    
HELIX  342 BL9 ASN E  937  GLN E  958  1                                  22    
HELIX  343 BM1 CYS E  959  ILE E  975  1                                  17    
HELIX  344 BM2 LEU E  985  ARG E  994  1                                  10    
HELIX  345 BM3 PRO E 1002  ILE E 1018  1                                  17    
HELIX  346 BM4 UNK E 1611  UNK E 1626  1                                  16    
HELIX  347 BM5 UNK E 1631  UNK E 1648  1                                  18    
HELIX  348 BM6 UNK E 1681  UNK E 1695  1                                  15    
HELIX  349 BM7 GLU F  193  ILE F  211  1                                  19    
HELIX  350 BM8 ILE F  216  LEU F  234  1                                  19    
HELIX  351 BM9 THR F  240  LEU F  250  1                                  11    
HELIX  352 BN1 TYR F  257  THR F  268  1                                  12    
HELIX  353 BN2 LEU F  273  GLU F  278  1                                   6    
HELIX  354 BN3 LEU F  282  PHE F  292  1                                  11    
HELIX  355 BN4 PHE F  292  GLY F  297  1                                   6    
HELIX  356 BN5 ILE F  298  LEU F  316  1                                  19    
HELIX  357 BN6 ASN F  320  LEU F  327  1                                   8    
HELIX  358 BN7 LEU F  327  LEU F  337  1                                  11    
HELIX  359 BN8 THR F  343  ASP F  354  1                                  12    
HELIX  360 BN9 SER F  365  LYS F  374  1                                  10    
HELIX  361 BO1 PRO F  378  PHE F  399  1                                  22    
HELIX  362 BO2 LEU F  405  VAL F  409  5                                   5    
HELIX  363 BO3 GLU F  410  HIS F  418  1                                   9    
HELIX  364 BO4 SER F  420  THR F  424  5                                   5    
HELIX  365 BO5 LEU F  430  CYS F  448  1                                  19    
HELIX  366 BO6 ALA F  456  ALA F  469  1                                  14    
HELIX  367 BO7 LEU F  473  LEU F  476  5                                   4    
HELIX  368 BO8 LYS F  477  LYS F  483  1                                   7    
HELIX  369 BO9 ILE F  498  LYS F  507  1                                  10    
HELIX  370 BP1 ARG F  513  GLN F  536  1                                  24    
HELIX  371 BP2 LYS F  541  ASN F  549  1                                   9    
HELIX  372 BP3 ILE F  551  TRP F  557  1                                   7    
HELIX  373 BP4 ASN F  564  LEU F  578  1                                  15    
HELIX  374 BP5 TYR F  581  ASP F  592  1                                  12    
HELIX  375 BP6 ASP F  594  THR F  609  1                                  16    
HELIX  376 BP7 GLU F  610  LEU F  613  5                                   4    
HELIX  377 BP8 TYR F  622  GLN F  632  1                                  11    
HELIX  378 BP9 ALA F  636  MET F  640  5                                   5    
HELIX  379 BQ1 LEU F  652  THR F  665  1                                  14    
HELIX  380 BQ2 MET F  675  VAL F  681  1                                   7    
HELIX  381 BQ3 ASN F  693  LEU F  705  1                                  13    
HELIX  382 BQ4 TYR F  731  VAL F  744  1                                  14    
HELIX  383 BQ5 GLY F  751  LYS F  764  1                                  14    
HELIX  384 BQ6 LYS F  764  ASP F  772  1                                   9    
HELIX  385 BQ7 GLY F  801  ILE F  811  1                                  11    
HELIX  386 BQ8 SER F  816  VAL F  824  1                                   9    
HELIX  387 BQ9 GLU F  829  ILE F  843  1                                  15    
HELIX  388 BR1 LEU F  847  ASP F  861  1                                  15    
HELIX  389 BR2 SER F  867  GLN F  872  5                                   6    
HELIX  390 BR3 ILE F  880  GLN F  885  1                                   6    
HELIX  391 BR4 LYS F  890  LEU F  896  1                                   7    
HELIX  392 BR5 LEU F  896  ARG F  907  1                                  12    
HELIX  393 BR6 THR F  911  LEU F  930  1                                  20    
HELIX  394 BR7 ASN F  937  GLN F  958  1                                  22    
HELIX  395 BR8 CYS F  959  ILE F  975  1                                  17    
HELIX  396 BR9 LEU F  985  ARG F  994  1                                  10    
HELIX  397 BS1 PRO F 1002  ILE F 1018  1                                  17    
HELIX  398 BS2 UNK F 1611  UNK F 1626  1                                  16    
HELIX  399 BS3 UNK F 1631  UNK F 1648  1                                  18    
HELIX  400 BS4 UNK F 1681  UNK F 1695  1                                  15    
HELIX  401 BS5 UNK G    9  UNK G   20  1                                  12    
HELIX  402 BS6 UNK G   49  UNK G   58  1                                  10    
HELIX  403 BS7 UNK G   66  UNK G   76  1                                  11    
HELIX  404 BS8 UNK G   89  UNK G  104  1                                  16    
HELIX  405 BS9 UNK H    9  UNK H   20  1                                  12    
HELIX  406 BT1 UNK H   49  UNK H   58  1                                  10    
HELIX  407 BT2 UNK H   66  UNK H   76  1                                  11    
HELIX  408 BT3 UNK H   90  UNK H  104  1                                  15    
SHEET    1 AA1 4 ARG A2170  MET A2175  0                                        
SHEET    2 AA1 4 GLU A2181  LYS A2187 -1  O  PHE A2184   N  LEU A2172           
SHEET    3 AA1 4 GLY A2235  ILE A2237 -1  O  ILE A2237   N  LEU A2185           
SHEET    4 AA1 4 ILE A2228  PRO A2229 -1  N  ILE A2228   O  LEU A2236           
SHEET    1 AA2 3 CYS A2243  ASP A2244  0                                        
SHEET    2 AA2 3 LEU A2344  ASP A2347 -1  O  LEU A2346   N  ASP A2244           
SHEET    3 AA2 3 ILE A2353  HIS A2355 -1  O  LEU A2354   N  MET A2345           
SHEET    1 AA3 4 ARG B2170  MET B2175  0                                        
SHEET    2 AA3 4 GLU B2181  LYS B2187 -1  O  PHE B2184   N  LEU B2172           
SHEET    3 AA3 4 GLY B2235  ILE B2237 -1  O  ILE B2237   N  LEU B2185           
SHEET    4 AA3 4 ILE B2228  PRO B2229 -1  N  ILE B2228   O  LEU B2236           
SHEET    1 AA4 3 CYS B2243  ASP B2244  0                                        
SHEET    2 AA4 3 LEU B2344  ASP B2347 -1  O  LEU B2346   N  ASP B2244           
SHEET    3 AA4 3 ILE B2353  HIS B2355 -1  O  LEU B2354   N  MET B2345           
SHEET    1 AA5 3 VAL C  24  TRP C  27  0                                        
SHEET    2 AA5 3 VAL C  13  ALA C  18 -1  N  THR C  17   O  ARG C  25           
SHEET    3 AA5 3 LEU C 318  ASP C 322 -1  O  ALA C 319   N  ALA C  16           
SHEET    1 AA6 3 VAL C  45  VAL C  50  0                                        
SHEET    2 AA6 3 MET C  56  GLY C  61 -1  O  ALA C  58   N  GLU C  49           
SHEET    3 AA6 3 MET C  67  ASP C  69 -1  O  TYR C  68   N  ILE C  57           
SHEET    1 AA7 3 SER C  90  PHE C  93  0                                        
SHEET    2 AA7 3 TRP C  99  GLY C 103 -1  O  TYR C 101   N  GLY C  92           
SHEET    3 AA7 3 TRP C 112  ASP C 113 -1  O  TRP C 112   N  MET C 100           
SHEET    1 AA8 4 ILE C 131  LEU C 136  0                                        
SHEET    2 AA8 4 GLU C 142  ASP C 147 -1  O  GLY C 146   N  ASN C 132           
SHEET    3 AA8 4 ILE C 152  ASP C 156 -1  O  HIS C 153   N  VAL C 145           
SHEET    4 AA8 4 GLU C 163  LEU C 165 -1  O  LEU C 165   N  ILE C 152           
SHEET    1 AA9 3 TYR C 184  VAL C 188  0                                        
SHEET    2 AA9 3 ASN C 193  ASN C 198 -1  O  TRP C 197   N  MET C 185           
SHEET    3 AA9 3 ILE C 211  PRO C 217 -1  O  LYS C 213   N  VAL C 196           
SHEET    1 AB1 3 ALA C 223  PHE C 228  0                                        
SHEET    2 AB1 3 LEU C 234  SER C 239 -1  O  CYS C 238   N  GLN C 225           
SHEET    3 AB1 3 TRP C 247  ARG C 248 -1  O  TRP C 247   N  LEU C 235           
SHEET    1 AB2 2 THR C 243  LYS C 245  0                                        
SHEET    2 AB2 2 GLU C 257  SER C 259 -1  O  LEU C 258   N  CYS C 244           
SHEET    1 AB3 2 ALA C 294  ARG C 295  0                                        
SHEET    2 AB3 2 GLU C 307  TYR C 308 -1  O  TYR C 308   N  ALA C 294           
SHEET    1 AB4 3 VAL D  24  TRP D  27  0                                        
SHEET    2 AB4 3 VAL D  13  ALA D  18 -1  N  THR D  17   O  ARG D  25           
SHEET    3 AB4 3 LEU D 318  ASP D 322 -1  O  ALA D 319   N  ALA D  16           
SHEET    1 AB5 3 VAL D  45  VAL D  50  0                                        
SHEET    2 AB5 3 MET D  56  GLY D  61 -1  O  ALA D  58   N  GLU D  49           
SHEET    3 AB5 3 MET D  67  ASP D  69 -1  O  TYR D  68   N  ILE D  57           
SHEET    1 AB6 3 SER D  90  PHE D  93  0                                        
SHEET    2 AB6 3 TRP D  99  GLY D 103 -1  O  TYR D 101   N  GLY D  92           
SHEET    3 AB6 3 TRP D 112  ASP D 113 -1  O  TRP D 112   N  MET D 100           
SHEET    1 AB7 4 ILE D 131  LEU D 136  0                                        
SHEET    2 AB7 4 GLU D 142  ASP D 147 -1  O  GLY D 146   N  ASN D 132           
SHEET    3 AB7 4 ILE D 152  ASP D 156 -1  O  HIS D 153   N  VAL D 145           
SHEET    4 AB7 4 GLU D 163  LEU D 165 -1  O  LEU D 165   N  ILE D 152           
SHEET    1 AB8 3 TYR D 184  VAL D 188  0                                        
SHEET    2 AB8 3 ASN D 193  ASN D 198 -1  O  TRP D 197   N  MET D 185           
SHEET    3 AB8 3 ILE D 211  PRO D 217 -1  O  LYS D 213   N  VAL D 196           
SHEET    1 AB9 3 ALA D 223  PHE D 228  0                                        
SHEET    2 AB9 3 LEU D 234  SER D 239 -1  O  CYS D 238   N  GLN D 225           
SHEET    3 AB9 3 TRP D 247  ARG D 248 -1  O  TRP D 247   N  LEU D 235           
SHEET    1 AC1 2 THR D 243  LYS D 245  0                                        
SHEET    2 AC1 2 GLU D 257  SER D 259 -1  O  LEU D 258   N  CYS D 244           
SHEET    1 AC2 2 ALA D 294  ARG D 295  0                                        
SHEET    2 AC2 2 GLU D 307  TYR D 308 -1  O  TYR D 308   N  ALA D 294           
CISPEP   1 LEU E  212    LYS E  213          0        -1.83                     
CISPEP   2 HIS E  237    PRO E  238          0        -4.87                     
CISPEP   3 PRO E  256    TYR E  257          0        -1.92                     
CISPEP   4 GLU E  429    LEU E  430          0         0.34                     
CISPEP   5 MET E  453    ASN E  454          0        -0.34                     
CISPEP   6 ASP E  495    HIS E  496          0         2.55                     
CISPEP   7 ASP E  509    GLN E  510          0        -1.38                     
CISPEP   8 VAL E  537    LEU E  538          0         0.33                     
CISPEP   9 ILE E  933    GLY E  934          0        -0.32                     
CISPEP  10 LEU F  212    LYS F  213          0        -1.85                     
CISPEP  11 HIS F  237    PRO F  238          0        -4.87                     
CISPEP  12 PRO F  256    TYR F  257          0        -1.90                     
CISPEP  13 GLU F  429    LEU F  430          0         0.30                     
CISPEP  14 MET F  453    ASN F  454          0        -0.36                     
CISPEP  15 ASP F  495    HIS F  496          0         2.65                     
CISPEP  16 ASP F  509    GLN F  510          0        -1.39                     
CISPEP  17 VAL F  537    LEU F  538          0         0.40                     
CISPEP  18 ILE F  933    GLY F  934          0        -0.36                     
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      1.000000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  1.000000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  1.000000        0.00000                         
(ATOM LINES ARE NOT SHOWN.)
END                                                                             
DBGET integrated database retrieval system