GenomeNet

Database: PDB
Entry: 6BWI
LinkDB: 6BWI
Original site: 6BWI 
HEADER    MEMBRANE PROTEIN                        15-DEC-17   6BWI              
TITLE     3.7 ANGSTROM CRYOEM STRUCTURE OF FULL LENGTH HUMAN TRPM4              
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL SUBFAMILY M    
COMPND   3 MEMBER 4;                                                            
COMPND   4 CHAIN: A, B, C, D;                                                   
COMPND   5 SYNONYM: HTRPM4,CALCIUM-ACTIVATED NON-SELECTIVE CATION CHANNEL 1,LONG
COMPND   6 TRANSIENT RECEPTOR POTENTIAL CHANNEL 4,LTRPC4,MELASTATIN-4;          
COMPND   7 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: TRPM4, LTRPC4;                                                 
SOURCE   6 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE   7 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE   8 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE   9 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS                           
KEYWDS    CRYOEM, HUMAN FULL LENGTH TRPM7, MEMBRANE PROTEIN                     
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    J.ZHANG,Z.LI,J.DUAN,J.LI,D.E.CLAPHAM                                  
REVDAT   4   29-JUL-20 6BWI    1       COMPND REMARK HETNAM LINK                
REVDAT   4 2                   1       SITE                                     
REVDAT   3   18-DEC-19 6BWI    1       CRYST1 SCALE                             
REVDAT   2   03-JUL-19 6BWI    1       JRNL                                     
REVDAT   1   19-DEC-18 6BWI    0                                                
JRNL        AUTH   J.DUAN,Z.LI,J.LI,A.SANTA-CRUZ,S.SANCHEZ-MARTINEZ,J.ZHANG,    
JRNL        AUTH 2 D.E.CLAPHAM                                                  
JRNL        TITL   STRUCTURE OF FULL-LENGTH HUMAN TRPM4.                        
JRNL        REF    PROC.NATL.ACAD.SCI.USA        V. 115  2377 2018              
JRNL        REFN                   ESSN 1091-6490                               
JRNL        PMID   29463718                                                     
JRNL        DOI    10.1073/PNAS.1722038115                                      
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.70 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : NULL                                      
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : NULL                                
REMARK   3   REFINEMENT SPACE             : NULL                                
REMARK   3   REFINEMENT PROTOCOL          : NULL                                
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 3.700                          
REMARK   3   NUMBER OF PARTICLES               : 232930                         
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING AND AMPLITUDE   
REMARK   3                                       CORRECTION                     
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 6BWI COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 19-DEC-17.                  
REMARK 100 THE DEPOSITION ID IS D_1000231719.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : HUMAN FULL LENGTH TRPM4           
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : NULL                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.50                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI POLARA 300                 
REMARK 245   DETECTOR TYPE                     : GATAN K2 SUMMIT (4K X 4K)      
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : NULL                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 56.00                          
REMARK 245   ILLUMINATION MODE                 : FLOOD BEAM                     
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: TETRAMERIC                        
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D                            
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     GLY A   448                                                      
REMARK 465     LEU A   449                                                      
REMARK 465     SER A   450                                                      
REMARK 465     HIS A   482                                                      
REMARK 465     SER A   483                                                      
REMARK 465     ALA A   484                                                      
REMARK 465     GLY A   485                                                      
REMARK 465     THR A   486                                                      
REMARK 465     LYS A   487                                                      
REMARK 465     ALA A   488                                                      
REMARK 465     PRO A   489                                                      
REMARK 465     ALA A   490                                                      
REMARK 465     LEU A   491                                                      
REMARK 465     LYS A   492                                                      
REMARK 465     GLY A   493                                                      
REMARK 465     GLY A   494                                                      
REMARK 465     ALA A   495                                                      
REMARK 465     ALA A   496                                                      
REMARK 465     GLU A   497                                                      
REMARK 465     LEU A   498                                                      
REMARK 465     ARG A   499                                                      
REMARK 465     PRO A   500                                                      
REMARK 465     PRO A   501                                                      
REMARK 465     ASP A   502                                                      
REMARK 465     VAL A   503                                                      
REMARK 465     GLY A   504                                                      
REMARK 465     HIS A   505                                                      
REMARK 465     VAL A   506                                                      
REMARK 465     LEU A   507                                                      
REMARK 465     ARG A   508                                                      
REMARK 465     MET A   509                                                      
REMARK 465     LEU A   510                                                      
REMARK 465     LEU A   511                                                      
REMARK 465     GLY A   512                                                      
REMARK 465     LYS A   513                                                      
REMARK 465     MET A   514                                                      
REMARK 465     CYS A   515                                                      
REMARK 465     ALA A   516                                                      
REMARK 465     PRO A   517                                                      
REMARK 465     ARG A   518                                                      
REMARK 465     TYR A   519                                                      
REMARK 465     PRO A   520                                                      
REMARK 465     SER A   521                                                      
REMARK 465     GLY A   522                                                      
REMARK 465     GLY A   523                                                      
REMARK 465     ALA A   524                                                      
REMARK 465     TRP A   525                                                      
REMARK 465     ASP A   526                                                      
REMARK 465     PRO A   527                                                      
REMARK 465     HIS A   528                                                      
REMARK 465     PRO A   529                                                      
REMARK 465     GLY A   530                                                      
REMARK 465     GLN A   531                                                      
REMARK 465     PRO A   547                                                      
REMARK 465     LEU A   548                                                      
REMARK 465     SER A   549                                                      
REMARK 465     LEU A   550                                                      
REMARK 465     ASP A   551                                                      
REMARK 465     ALA A   552                                                      
REMARK 465     GLY A   553                                                      
REMARK 465     LEU A   554                                                      
REMARK 465     GLY A   555                                                      
REMARK 465     GLN A   556                                                      
REMARK 465     ALA A   557                                                      
REMARK 465     PRO A   558                                                      
REMARK 465     LYS A   712                                                      
REMARK 465     SER A   713                                                      
REMARK 465     GLU A   714                                                      
REMARK 465     GLU A   715                                                      
REMARK 465     GLU A   716                                                      
REMARK 465     PRO A   717                                                      
REMARK 465     THR A   718                                                      
REMARK 465     ARG A   719                                                      
REMARK 465     GLU A   720                                                      
REMARK 465     GLU A   721                                                      
REMARK 465     LEU A   722                                                      
REMARK 465     GLU A   723                                                      
REMARK 465     PHE A   724                                                      
REMARK 465     ASP A   725                                                      
REMARK 465     MET A   726                                                      
REMARK 465     ASP A   727                                                      
REMARK 465     SER A   728                                                      
REMARK 465     VAL A   729                                                      
REMARK 465     ILE A   730                                                      
REMARK 465     ASN A   731                                                      
REMARK 465     GLY A   732                                                      
REMARK 465     GLU A   733                                                      
REMARK 465     GLY A   734                                                      
REMARK 465     PRO A   735                                                      
REMARK 465     VAL A   736                                                      
REMARK 465     GLY A   737                                                      
REMARK 465     THR A   738                                                      
REMARK 465     ALA A   739                                                      
REMARK 465     ASP A   740                                                      
REMARK 465     PRO A   741                                                      
REMARK 465     ALA A   742                                                      
REMARK 465     GLU A   743                                                      
REMARK 465     LYS A   744                                                      
REMARK 465     THR A   745                                                      
REMARK 465     PRO A   746                                                      
REMARK 465     LEU A   747                                                      
REMARK 465     GLY A   748                                                      
REMARK 465     VAL A   749                                                      
REMARK 465     PRO A   750                                                      
REMARK 465     ARG A   751                                                      
REMARK 465     GLN A   752                                                      
REMARK 465     SER A   753                                                      
REMARK 465     GLY A   754                                                      
REMARK 465     ARG A   755                                                      
REMARK 465     PRO A   756                                                      
REMARK 465     GLY A   757                                                      
REMARK 465     CYS A   758                                                      
REMARK 465     CYS A   759                                                      
REMARK 465     GLY A   760                                                      
REMARK 465     GLY A   761                                                      
REMARK 465     ARG A   762                                                      
REMARK 465     CYS A   763                                                      
REMARK 465     GLY A   764                                                      
REMARK 465     GLY A   765                                                      
REMARK 465     ARG A   766                                                      
REMARK 465     ARG A   767                                                      
REMARK 465     SER A   834                                                      
REMARK 465     GLY A   835                                                      
REMARK 465     GLY A   836                                                      
REMARK 465     GLY A   837                                                      
REMARK 465     GLY A   838                                                      
REMARK 465     SER A   839                                                      
REMARK 465     LEU A   840                                                      
REMARK 465     ALA A   841                                                      
REMARK 465     SER A   842                                                      
REMARK 465     GLY A   843                                                      
REMARK 465     GLY A   844                                                      
REMARK 465     PRO A   845                                                      
REMARK 465     GLY A   846                                                      
REMARK 465     PRO A   847                                                      
REMARK 465     GLY A   848                                                      
REMARK 465     HIS A   849                                                      
REMARK 465     CYS A  1093                                                      
REMARK 465     ARG A  1094                                                      
REMARK 465     ARG A  1095                                                      
REMARK 465     PRO A  1096                                                      
REMARK 465     ARG A  1097                                                      
REMARK 465     SER A  1098                                                      
REMARK 465     PRO A  1099                                                      
REMARK 465     GLN A  1100                                                      
REMARK 465     PRO A  1101                                                      
REMARK 465     SER A  1102                                                      
REMARK 465     SER A  1103                                                      
REMARK 465     PRO A  1104                                                      
REMARK 465     ALA A  1105                                                      
REMARK 465     LEU A  1106                                                      
REMARK 465     GLU A  1107                                                      
REMARK 465     HIS A  1108                                                      
REMARK 465     PHE A  1109                                                      
REMARK 465     ARG A  1110                                                      
REMARK 465     VAL A  1111                                                      
REMARK 465     TYR A  1112                                                      
REMARK 465     LEU A  1113                                                      
REMARK 465     SER A  1114                                                      
REMARK 465     LEU A  1175                                                      
REMARK 465     GLU A  1176                                                      
REMARK 465     GLY B   448                                                      
REMARK 465     LEU B   449                                                      
REMARK 465     SER B   450                                                      
REMARK 465     HIS B   482                                                      
REMARK 465     SER B   483                                                      
REMARK 465     ALA B   484                                                      
REMARK 465     GLY B   485                                                      
REMARK 465     THR B   486                                                      
REMARK 465     LYS B   487                                                      
REMARK 465     ALA B   488                                                      
REMARK 465     PRO B   489                                                      
REMARK 465     ALA B   490                                                      
REMARK 465     LEU B   491                                                      
REMARK 465     LYS B   492                                                      
REMARK 465     GLY B   493                                                      
REMARK 465     GLY B   494                                                      
REMARK 465     ALA B   495                                                      
REMARK 465     ALA B   496                                                      
REMARK 465     GLU B   497                                                      
REMARK 465     LEU B   498                                                      
REMARK 465     ARG B   499                                                      
REMARK 465     PRO B   500                                                      
REMARK 465     PRO B   501                                                      
REMARK 465     ASP B   502                                                      
REMARK 465     VAL B   503                                                      
REMARK 465     GLY B   504                                                      
REMARK 465     HIS B   505                                                      
REMARK 465     VAL B   506                                                      
REMARK 465     LEU B   507                                                      
REMARK 465     ARG B   508                                                      
REMARK 465     MET B   509                                                      
REMARK 465     LEU B   510                                                      
REMARK 465     LEU B   511                                                      
REMARK 465     GLY B   512                                                      
REMARK 465     LYS B   513                                                      
REMARK 465     MET B   514                                                      
REMARK 465     CYS B   515                                                      
REMARK 465     ALA B   516                                                      
REMARK 465     PRO B   517                                                      
REMARK 465     ARG B   518                                                      
REMARK 465     TYR B   519                                                      
REMARK 465     PRO B   520                                                      
REMARK 465     SER B   521                                                      
REMARK 465     GLY B   522                                                      
REMARK 465     GLY B   523                                                      
REMARK 465     ALA B   524                                                      
REMARK 465     TRP B   525                                                      
REMARK 465     ASP B   526                                                      
REMARK 465     PRO B   527                                                      
REMARK 465     HIS B   528                                                      
REMARK 465     PRO B   529                                                      
REMARK 465     GLY B   530                                                      
REMARK 465     GLN B   531                                                      
REMARK 465     PRO B   547                                                      
REMARK 465     LEU B   548                                                      
REMARK 465     SER B   549                                                      
REMARK 465     LEU B   550                                                      
REMARK 465     ASP B   551                                                      
REMARK 465     ALA B   552                                                      
REMARK 465     GLY B   553                                                      
REMARK 465     LEU B   554                                                      
REMARK 465     GLY B   555                                                      
REMARK 465     GLN B   556                                                      
REMARK 465     ALA B   557                                                      
REMARK 465     PRO B   558                                                      
REMARK 465     LYS B   712                                                      
REMARK 465     SER B   713                                                      
REMARK 465     GLU B   714                                                      
REMARK 465     GLU B   715                                                      
REMARK 465     GLU B   716                                                      
REMARK 465     PRO B   717                                                      
REMARK 465     THR B   718                                                      
REMARK 465     ARG B   719                                                      
REMARK 465     GLU B   720                                                      
REMARK 465     GLU B   721                                                      
REMARK 465     LEU B   722                                                      
REMARK 465     GLU B   723                                                      
REMARK 465     PHE B   724                                                      
REMARK 465     ASP B   725                                                      
REMARK 465     MET B   726                                                      
REMARK 465     ASP B   727                                                      
REMARK 465     SER B   728                                                      
REMARK 465     VAL B   729                                                      
REMARK 465     ILE B   730                                                      
REMARK 465     ASN B   731                                                      
REMARK 465     GLY B   732                                                      
REMARK 465     GLU B   733                                                      
REMARK 465     GLY B   734                                                      
REMARK 465     PRO B   735                                                      
REMARK 465     VAL B   736                                                      
REMARK 465     GLY B   737                                                      
REMARK 465     THR B   738                                                      
REMARK 465     ALA B   739                                                      
REMARK 465     ASP B   740                                                      
REMARK 465     PRO B   741                                                      
REMARK 465     ALA B   742                                                      
REMARK 465     GLU B   743                                                      
REMARK 465     LYS B   744                                                      
REMARK 465     THR B   745                                                      
REMARK 465     PRO B   746                                                      
REMARK 465     LEU B   747                                                      
REMARK 465     GLY B   748                                                      
REMARK 465     VAL B   749                                                      
REMARK 465     PRO B   750                                                      
REMARK 465     ARG B   751                                                      
REMARK 465     GLN B   752                                                      
REMARK 465     SER B   753                                                      
REMARK 465     GLY B   754                                                      
REMARK 465     ARG B   755                                                      
REMARK 465     PRO B   756                                                      
REMARK 465     GLY B   757                                                      
REMARK 465     CYS B   758                                                      
REMARK 465     CYS B   759                                                      
REMARK 465     GLY B   760                                                      
REMARK 465     GLY B   761                                                      
REMARK 465     ARG B   762                                                      
REMARK 465     CYS B   763                                                      
REMARK 465     GLY B   764                                                      
REMARK 465     GLY B   765                                                      
REMARK 465     ARG B   766                                                      
REMARK 465     ARG B   767                                                      
REMARK 465     SER B   834                                                      
REMARK 465     GLY B   835                                                      
REMARK 465     GLY B   836                                                      
REMARK 465     GLY B   837                                                      
REMARK 465     GLY B   838                                                      
REMARK 465     SER B   839                                                      
REMARK 465     LEU B   840                                                      
REMARK 465     ALA B   841                                                      
REMARK 465     SER B   842                                                      
REMARK 465     GLY B   843                                                      
REMARK 465     GLY B   844                                                      
REMARK 465     PRO B   845                                                      
REMARK 465     GLY B   846                                                      
REMARK 465     PRO B   847                                                      
REMARK 465     GLY B   848                                                      
REMARK 465     HIS B   849                                                      
REMARK 465     CYS B  1093                                                      
REMARK 465     ARG B  1094                                                      
REMARK 465     ARG B  1095                                                      
REMARK 465     PRO B  1096                                                      
REMARK 465     ARG B  1097                                                      
REMARK 465     SER B  1098                                                      
REMARK 465     PRO B  1099                                                      
REMARK 465     GLN B  1100                                                      
REMARK 465     PRO B  1101                                                      
REMARK 465     SER B  1102                                                      
REMARK 465     SER B  1103                                                      
REMARK 465     PRO B  1104                                                      
REMARK 465     ALA B  1105                                                      
REMARK 465     LEU B  1106                                                      
REMARK 465     GLU B  1107                                                      
REMARK 465     HIS B  1108                                                      
REMARK 465     PHE B  1109                                                      
REMARK 465     ARG B  1110                                                      
REMARK 465     VAL B  1111                                                      
REMARK 465     TYR B  1112                                                      
REMARK 465     LEU B  1113                                                      
REMARK 465     SER B  1114                                                      
REMARK 465     LEU B  1175                                                      
REMARK 465     GLU B  1176                                                      
REMARK 465     GLY C   448                                                      
REMARK 465     LEU C   449                                                      
REMARK 465     SER C   450                                                      
REMARK 465     HIS C   482                                                      
REMARK 465     SER C   483                                                      
REMARK 465     ALA C   484                                                      
REMARK 465     GLY C   485                                                      
REMARK 465     THR C   486                                                      
REMARK 465     LYS C   487                                                      
REMARK 465     ALA C   488                                                      
REMARK 465     PRO C   489                                                      
REMARK 465     ALA C   490                                                      
REMARK 465     LEU C   491                                                      
REMARK 465     LYS C   492                                                      
REMARK 465     GLY C   493                                                      
REMARK 465     GLY C   494                                                      
REMARK 465     ALA C   495                                                      
REMARK 465     ALA C   496                                                      
REMARK 465     GLU C   497                                                      
REMARK 465     LEU C   498                                                      
REMARK 465     ARG C   499                                                      
REMARK 465     PRO C   500                                                      
REMARK 465     PRO C   501                                                      
REMARK 465     ASP C   502                                                      
REMARK 465     VAL C   503                                                      
REMARK 465     GLY C   504                                                      
REMARK 465     HIS C   505                                                      
REMARK 465     VAL C   506                                                      
REMARK 465     LEU C   507                                                      
REMARK 465     ARG C   508                                                      
REMARK 465     MET C   509                                                      
REMARK 465     LEU C   510                                                      
REMARK 465     LEU C   511                                                      
REMARK 465     GLY C   512                                                      
REMARK 465     LYS C   513                                                      
REMARK 465     MET C   514                                                      
REMARK 465     CYS C   515                                                      
REMARK 465     ALA C   516                                                      
REMARK 465     PRO C   517                                                      
REMARK 465     ARG C   518                                                      
REMARK 465     TYR C   519                                                      
REMARK 465     PRO C   520                                                      
REMARK 465     SER C   521                                                      
REMARK 465     GLY C   522                                                      
REMARK 465     GLY C   523                                                      
REMARK 465     ALA C   524                                                      
REMARK 465     TRP C   525                                                      
REMARK 465     ASP C   526                                                      
REMARK 465     PRO C   527                                                      
REMARK 465     HIS C   528                                                      
REMARK 465     PRO C   529                                                      
REMARK 465     GLY C   530                                                      
REMARK 465     GLN C   531                                                      
REMARK 465     PRO C   547                                                      
REMARK 465     LEU C   548                                                      
REMARK 465     SER C   549                                                      
REMARK 465     LEU C   550                                                      
REMARK 465     ASP C   551                                                      
REMARK 465     ALA C   552                                                      
REMARK 465     GLY C   553                                                      
REMARK 465     LEU C   554                                                      
REMARK 465     GLY C   555                                                      
REMARK 465     GLN C   556                                                      
REMARK 465     ALA C   557                                                      
REMARK 465     PRO C   558                                                      
REMARK 465     LYS C   712                                                      
REMARK 465     SER C   713                                                      
REMARK 465     GLU C   714                                                      
REMARK 465     GLU C   715                                                      
REMARK 465     GLU C   716                                                      
REMARK 465     PRO C   717                                                      
REMARK 465     THR C   718                                                      
REMARK 465     ARG C   719                                                      
REMARK 465     GLU C   720                                                      
REMARK 465     GLU C   721                                                      
REMARK 465     LEU C   722                                                      
REMARK 465     GLU C   723                                                      
REMARK 465     PHE C   724                                                      
REMARK 465     ASP C   725                                                      
REMARK 465     MET C   726                                                      
REMARK 465     ASP C   727                                                      
REMARK 465     SER C   728                                                      
REMARK 465     VAL C   729                                                      
REMARK 465     ILE C   730                                                      
REMARK 465     ASN C   731                                                      
REMARK 465     GLY C   732                                                      
REMARK 465     GLU C   733                                                      
REMARK 465     GLY C   734                                                      
REMARK 465     PRO C   735                                                      
REMARK 465     VAL C   736                                                      
REMARK 465     GLY C   737                                                      
REMARK 465     THR C   738                                                      
REMARK 465     ALA C   739                                                      
REMARK 465     ASP C   740                                                      
REMARK 465     PRO C   741                                                      
REMARK 465     ALA C   742                                                      
REMARK 465     GLU C   743                                                      
REMARK 465     LYS C   744                                                      
REMARK 465     THR C   745                                                      
REMARK 465     PRO C   746                                                      
REMARK 465     LEU C   747                                                      
REMARK 465     GLY C   748                                                      
REMARK 465     VAL C   749                                                      
REMARK 465     PRO C   750                                                      
REMARK 465     ARG C   751                                                      
REMARK 465     GLN C   752                                                      
REMARK 465     SER C   753                                                      
REMARK 465     GLY C   754                                                      
REMARK 465     ARG C   755                                                      
REMARK 465     PRO C   756                                                      
REMARK 465     GLY C   757                                                      
REMARK 465     CYS C   758                                                      
REMARK 465     CYS C   759                                                      
REMARK 465     GLY C   760                                                      
REMARK 465     GLY C   761                                                      
REMARK 465     ARG C   762                                                      
REMARK 465     CYS C   763                                                      
REMARK 465     GLY C   764                                                      
REMARK 465     GLY C   765                                                      
REMARK 465     ARG C   766                                                      
REMARK 465     ARG C   767                                                      
REMARK 465     SER C   834                                                      
REMARK 465     GLY C   835                                                      
REMARK 465     GLY C   836                                                      
REMARK 465     GLY C   837                                                      
REMARK 465     GLY C   838                                                      
REMARK 465     SER C   839                                                      
REMARK 465     LEU C   840                                                      
REMARK 465     ALA C   841                                                      
REMARK 465     SER C   842                                                      
REMARK 465     GLY C   843                                                      
REMARK 465     GLY C   844                                                      
REMARK 465     PRO C   845                                                      
REMARK 465     GLY C   846                                                      
REMARK 465     PRO C   847                                                      
REMARK 465     GLY C   848                                                      
REMARK 465     HIS C   849                                                      
REMARK 465     CYS C  1093                                                      
REMARK 465     ARG C  1094                                                      
REMARK 465     ARG C  1095                                                      
REMARK 465     PRO C  1096                                                      
REMARK 465     ARG C  1097                                                      
REMARK 465     SER C  1098                                                      
REMARK 465     PRO C  1099                                                      
REMARK 465     GLN C  1100                                                      
REMARK 465     PRO C  1101                                                      
REMARK 465     SER C  1102                                                      
REMARK 465     SER C  1103                                                      
REMARK 465     PRO C  1104                                                      
REMARK 465     ALA C  1105                                                      
REMARK 465     LEU C  1106                                                      
REMARK 465     GLU C  1107                                                      
REMARK 465     HIS C  1108                                                      
REMARK 465     PHE C  1109                                                      
REMARK 465     ARG C  1110                                                      
REMARK 465     VAL C  1111                                                      
REMARK 465     TYR C  1112                                                      
REMARK 465     LEU C  1113                                                      
REMARK 465     SER C  1114                                                      
REMARK 465     LEU C  1175                                                      
REMARK 465     GLU C  1176                                                      
REMARK 465     GLY D   448                                                      
REMARK 465     LEU D   449                                                      
REMARK 465     SER D   450                                                      
REMARK 465     HIS D   482                                                      
REMARK 465     SER D   483                                                      
REMARK 465     ALA D   484                                                      
REMARK 465     GLY D   485                                                      
REMARK 465     THR D   486                                                      
REMARK 465     LYS D   487                                                      
REMARK 465     ALA D   488                                                      
REMARK 465     PRO D   489                                                      
REMARK 465     ALA D   490                                                      
REMARK 465     LEU D   491                                                      
REMARK 465     LYS D   492                                                      
REMARK 465     GLY D   493                                                      
REMARK 465     GLY D   494                                                      
REMARK 465     ALA D   495                                                      
REMARK 465     ALA D   496                                                      
REMARK 465     GLU D   497                                                      
REMARK 465     LEU D   498                                                      
REMARK 465     ARG D   499                                                      
REMARK 465     PRO D   500                                                      
REMARK 465     PRO D   501                                                      
REMARK 465     ASP D   502                                                      
REMARK 465     VAL D   503                                                      
REMARK 465     GLY D   504                                                      
REMARK 465     HIS D   505                                                      
REMARK 465     VAL D   506                                                      
REMARK 465     LEU D   507                                                      
REMARK 465     ARG D   508                                                      
REMARK 465     MET D   509                                                      
REMARK 465     LEU D   510                                                      
REMARK 465     LEU D   511                                                      
REMARK 465     GLY D   512                                                      
REMARK 465     LYS D   513                                                      
REMARK 465     MET D   514                                                      
REMARK 465     CYS D   515                                                      
REMARK 465     ALA D   516                                                      
REMARK 465     PRO D   517                                                      
REMARK 465     ARG D   518                                                      
REMARK 465     TYR D   519                                                      
REMARK 465     PRO D   520                                                      
REMARK 465     SER D   521                                                      
REMARK 465     GLY D   522                                                      
REMARK 465     GLY D   523                                                      
REMARK 465     ALA D   524                                                      
REMARK 465     TRP D   525                                                      
REMARK 465     ASP D   526                                                      
REMARK 465     PRO D   527                                                      
REMARK 465     HIS D   528                                                      
REMARK 465     PRO D   529                                                      
REMARK 465     GLY D   530                                                      
REMARK 465     GLN D   531                                                      
REMARK 465     PRO D   547                                                      
REMARK 465     LEU D   548                                                      
REMARK 465     SER D   549                                                      
REMARK 465     LEU D   550                                                      
REMARK 465     ASP D   551                                                      
REMARK 465     ALA D   552                                                      
REMARK 465     GLY D   553                                                      
REMARK 465     LEU D   554                                                      
REMARK 465     GLY D   555                                                      
REMARK 465     GLN D   556                                                      
REMARK 465     ALA D   557                                                      
REMARK 465     PRO D   558                                                      
REMARK 465     LYS D   712                                                      
REMARK 465     SER D   713                                                      
REMARK 465     GLU D   714                                                      
REMARK 465     GLU D   715                                                      
REMARK 465     GLU D   716                                                      
REMARK 465     PRO D   717                                                      
REMARK 465     THR D   718                                                      
REMARK 465     ARG D   719                                                      
REMARK 465     GLU D   720                                                      
REMARK 465     GLU D   721                                                      
REMARK 465     LEU D   722                                                      
REMARK 465     GLU D   723                                                      
REMARK 465     PHE D   724                                                      
REMARK 465     ASP D   725                                                      
REMARK 465     MET D   726                                                      
REMARK 465     ASP D   727                                                      
REMARK 465     SER D   728                                                      
REMARK 465     VAL D   729                                                      
REMARK 465     ILE D   730                                                      
REMARK 465     ASN D   731                                                      
REMARK 465     GLY D   732                                                      
REMARK 465     GLU D   733                                                      
REMARK 465     GLY D   734                                                      
REMARK 465     PRO D   735                                                      
REMARK 465     VAL D   736                                                      
REMARK 465     GLY D   737                                                      
REMARK 465     THR D   738                                                      
REMARK 465     ALA D   739                                                      
REMARK 465     ASP D   740                                                      
REMARK 465     PRO D   741                                                      
REMARK 465     ALA D   742                                                      
REMARK 465     GLU D   743                                                      
REMARK 465     LYS D   744                                                      
REMARK 465     THR D   745                                                      
REMARK 465     PRO D   746                                                      
REMARK 465     LEU D   747                                                      
REMARK 465     GLY D   748                                                      
REMARK 465     VAL D   749                                                      
REMARK 465     PRO D   750                                                      
REMARK 465     ARG D   751                                                      
REMARK 465     GLN D   752                                                      
REMARK 465     SER D   753                                                      
REMARK 465     GLY D   754                                                      
REMARK 465     ARG D   755                                                      
REMARK 465     PRO D   756                                                      
REMARK 465     GLY D   757                                                      
REMARK 465     CYS D   758                                                      
REMARK 465     CYS D   759                                                      
REMARK 465     GLY D   760                                                      
REMARK 465     GLY D   761                                                      
REMARK 465     ARG D   762                                                      
REMARK 465     CYS D   763                                                      
REMARK 465     GLY D   764                                                      
REMARK 465     GLY D   765                                                      
REMARK 465     ARG D   766                                                      
REMARK 465     ARG D   767                                                      
REMARK 465     SER D   834                                                      
REMARK 465     GLY D   835                                                      
REMARK 465     GLY D   836                                                      
REMARK 465     GLY D   837                                                      
REMARK 465     GLY D   838                                                      
REMARK 465     SER D   839                                                      
REMARK 465     LEU D   840                                                      
REMARK 465     ALA D   841                                                      
REMARK 465     SER D   842                                                      
REMARK 465     GLY D   843                                                      
REMARK 465     GLY D   844                                                      
REMARK 465     PRO D   845                                                      
REMARK 465     GLY D   846                                                      
REMARK 465     PRO D   847                                                      
REMARK 465     GLY D   848                                                      
REMARK 465     HIS D   849                                                      
REMARK 465     CYS D  1093                                                      
REMARK 465     ARG D  1094                                                      
REMARK 465     ARG D  1095                                                      
REMARK 465     PRO D  1096                                                      
REMARK 465     ARG D  1097                                                      
REMARK 465     SER D  1098                                                      
REMARK 465     PRO D  1099                                                      
REMARK 465     GLN D  1100                                                      
REMARK 465     PRO D  1101                                                      
REMARK 465     SER D  1102                                                      
REMARK 465     SER D  1103                                                      
REMARK 465     PRO D  1104                                                      
REMARK 465     ALA D  1105                                                      
REMARK 465     LEU D  1106                                                      
REMARK 465     GLU D  1107                                                      
REMARK 465     HIS D  1108                                                      
REMARK 465     PHE D  1109                                                      
REMARK 465     ARG D  1110                                                      
REMARK 465     VAL D  1111                                                      
REMARK 465     TYR D  1112                                                      
REMARK 465     LEU D  1113                                                      
REMARK 465     SER D  1114                                                      
REMARK 465     LEU D  1175                                                      
REMARK 465     GLU D  1176                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     GLU A 396    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 407    CG   OD1  OD2                                       
REMARK 470     GLN A 410    CG   CD   OE1  NE2                                  
REMARK 470     GLU A 412    CG   CD   OE1  OE2                                  
REMARK 470     ARG A 415    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE A 418    CG1  CG2  CD1                                       
REMARK 470     TRP A 420    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP A 420    CZ3  CH2                                            
REMARK 470     ARG A 421    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE A 423    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS A 424    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU A 425    CG   CD1  CD2                                       
REMARK 470     GLU A 426    CG   CD   OE1  OE2                                  
REMARK 470     SER A 428    OG                                                  
REMARK 470     LEU A 429    CG   CD1  CD2                                       
REMARK 470     LEU A 433    CG   CD1  CD2                                       
REMARK 470     LEU A 434    CG   CD1  CD2                                       
REMARK 470     ASN A 435    CG   OD1  ND2                                       
REMARK 470     ASP A 436    CG   OD1  OD2                                       
REMARK 470     ARG A 437    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU A 444    CG   CD1  CD2                                       
REMARK 470     ILE A 445    CG1  CG2  CD1                                       
REMARK 470     LEU A 451    CG   CD1  CD2                                       
REMARK 470     PHE A 454    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU A 455    CG   CD1  CD2                                       
REMARK 470     THR A 456    OG1  CG2                                            
REMARK 470     PRO A 457    CG   CD                                             
REMARK 470     MET A 458    CG   SD   CE                                        
REMARK 470     ASN A 470    CG   OD1  ND2                                       
REMARK 470     LEU A 472    CG   CD1  CD2                                       
REMARK 470     ASP A 478    CG   OD1  OD2                                       
REMARK 470     GLN A 479    CG   CD   OE1  NE2                                  
REMARK 470     GLU A 535    CG   CD   OE1  OE2                                  
REMARK 470     MET A 537    CG   SD   CE                                        
REMARK 470     TYR A 538    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU A 539    CG   CD1  CD2                                       
REMARK 470     LYS A 543    CG   CD   CE   NZ                                   
REMARK 470     ASP A 561    CG   OD1  OD2                                       
REMARK 470     ASN A 570    CG   OD1  ND2                                       
REMARK 470     GLU A 608    CG   CD   OE1  OE2                                  
REMARK 470     ARG A 612    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP A 614    CG   OD1  OD2                                       
REMARK 470     MET A 622    CG   SD   CE                                        
REMARK 470     GLU A 629    CG   CD   OE1  OE2                                  
REMARK 470     GLU A 635    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 651    CG   OD1  OD2                                       
REMARK 470     MET A 659    CG   SD   CE                                        
REMARK 470     GLN A 660    CG   CD   OE1  NE2                                  
REMARK 470     ASP A 662    CG   OD1  OD2                                       
REMARK 470     ASP A 683    CG   OD1  OD2                                       
REMARK 470     THR A 688    OG1  CG2                                            
REMARK 470     PHE A 698    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS A 699    SG                                                  
REMARK 470     PRO A 701    CG   CD                                             
REMARK 470     LEU A 702    CG   CD1  CD2                                       
REMARK 470     ILE A 703    CG1  CG2  CD1                                       
REMARK 470     THR A 705    OG1  CG2                                            
REMARK 470     LEU A 707    CG   CD1  CD2                                       
REMARK 470     ILE A 708    CG1  CG2  CD1                                       
REMARK 470     THR A 709    OG1  CG2                                            
REMARK 470     ARG A 711    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG A 770    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU A 814    CG   CD   OE1  OE2                                  
REMARK 470     LEU A 858    CG   CD1  CD2                                       
REMARK 470     ASP A 862    CG   OD1  OD2                                       
REMARK 470     THR A 873    OG1  CG2                                            
REMARK 470     LEU A 883    CG   CD1  CD2                                       
REMARK 470     LYS A 914    CG   CD   CE   NZ                                   
REMARK 470     GLN A 915    CG   CD   OE1  NE2                                  
REMARK 470     MET A 927    CG   SD   CE                                        
REMARK 470     ASP A 956    CG   OD1  OD2                                       
REMARK 470     GLU A 981    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 982    CG   OD1  OD2                                       
REMARK 470     MET A 988    CG   SD   CE                                        
REMARK 470     GLU A 989    CG   CD   OE1  OE2                                  
REMARK 470     GLU A 996    CG   CD   OE1  OE2                                  
REMARK 470     TYR A1057    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN A1061    CG   CD   OE1  NE2                                  
REMARK 470     LEU A1075    CG   CD1  CD2                                       
REMARK 470     PHE A1079    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE A1080    CG1  CG2  CD1                                       
REMARK 470     HIS A1084    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG A1090    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU A1116    CG   CD   OE1  OE2                                  
REMARK 470     ARG A1119    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS A1120    CG   CD   CE   NZ                                   
REMARK 470     ARG A1141    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU A1142    CG   CD   OE1  OE2                                  
REMARK 470     SER A1145    OG                                                  
REMARK 470     GLU A1146    CG   CD   OE1  OE2                                  
REMARK 470     GLU A1167    CG   CD   OE1  OE2                                  
REMARK 470     TYR A1168    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN A1170    CG   CD   OE1  NE2                                  
REMARK 470     ARG A1171    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU A1172    CG   CD1  CD2                                       
REMARK 470     LYS A1173    CG   CD   CE   NZ                                   
REMARK 470     GLU B 396    CG   CD   OE1  OE2                                  
REMARK 470     ASP B 407    CG   OD1  OD2                                       
REMARK 470     GLN B 410    CG   CD   OE1  NE2                                  
REMARK 470     GLU B 412    CG   CD   OE1  OE2                                  
REMARK 470     ARG B 415    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE B 418    CG1  CG2  CD1                                       
REMARK 470     TRP B 420    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP B 420    CZ3  CH2                                            
REMARK 470     ARG B 421    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE B 423    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS B 424    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU B 425    CG   CD1  CD2                                       
REMARK 470     GLU B 426    CG   CD   OE1  OE2                                  
REMARK 470     SER B 428    OG                                                  
REMARK 470     LEU B 429    CG   CD1  CD2                                       
REMARK 470     LEU B 433    CG   CD1  CD2                                       
REMARK 470     LEU B 434    CG   CD1  CD2                                       
REMARK 470     ASN B 435    CG   OD1  ND2                                       
REMARK 470     ASP B 436    CG   OD1  OD2                                       
REMARK 470     ARG B 437    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU B 444    CG   CD1  CD2                                       
REMARK 470     ILE B 445    CG1  CG2  CD1                                       
REMARK 470     LEU B 451    CG   CD1  CD2                                       
REMARK 470     PHE B 454    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU B 455    CG   CD1  CD2                                       
REMARK 470     THR B 456    OG1  CG2                                            
REMARK 470     PRO B 457    CG   CD                                             
REMARK 470     MET B 458    CG   SD   CE                                        
REMARK 470     ASN B 470    CG   OD1  ND2                                       
REMARK 470     LEU B 472    CG   CD1  CD2                                       
REMARK 470     ASP B 478    CG   OD1  OD2                                       
REMARK 470     GLN B 479    CG   CD   OE1  NE2                                  
REMARK 470     GLU B 535    CG   CD   OE1  OE2                                  
REMARK 470     MET B 537    CG   SD   CE                                        
REMARK 470     TYR B 538    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU B 539    CG   CD1  CD2                                       
REMARK 470     LYS B 543    CG   CD   CE   NZ                                   
REMARK 470     ASP B 561    CG   OD1  OD2                                       
REMARK 470     ASN B 570    CG   OD1  ND2                                       
REMARK 470     GLU B 608    CG   CD   OE1  OE2                                  
REMARK 470     ARG B 612    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP B 614    CG   OD1  OD2                                       
REMARK 470     MET B 622    CG   SD   CE                                        
REMARK 470     GLU B 629    CG   CD   OE1  OE2                                  
REMARK 470     GLU B 635    CG   CD   OE1  OE2                                  
REMARK 470     ASP B 651    CG   OD1  OD2                                       
REMARK 470     MET B 659    CG   SD   CE                                        
REMARK 470     GLN B 660    CG   CD   OE1  NE2                                  
REMARK 470     ASP B 662    CG   OD1  OD2                                       
REMARK 470     ASP B 683    CG   OD1  OD2                                       
REMARK 470     THR B 688    OG1  CG2                                            
REMARK 470     PHE B 698    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS B 699    SG                                                  
REMARK 470     PRO B 701    CG   CD                                             
REMARK 470     LEU B 702    CG   CD1  CD2                                       
REMARK 470     ILE B 703    CG1  CG2  CD1                                       
REMARK 470     THR B 705    OG1  CG2                                            
REMARK 470     LEU B 707    CG   CD1  CD2                                       
REMARK 470     ILE B 708    CG1  CG2  CD1                                       
REMARK 470     THR B 709    OG1  CG2                                            
REMARK 470     ARG B 711    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG B 770    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU B 814    CG   CD   OE1  OE2                                  
REMARK 470     LEU B 858    CG   CD1  CD2                                       
REMARK 470     ASP B 862    CG   OD1  OD2                                       
REMARK 470     THR B 873    OG1  CG2                                            
REMARK 470     LEU B 883    CG   CD1  CD2                                       
REMARK 470     LYS B 914    CG   CD   CE   NZ                                   
REMARK 470     GLN B 915    CG   CD   OE1  NE2                                  
REMARK 470     MET B 927    CG   SD   CE                                        
REMARK 470     ASP B 956    CG   OD1  OD2                                       
REMARK 470     GLU B 981    CG   CD   OE1  OE2                                  
REMARK 470     ASP B 982    CG   OD1  OD2                                       
REMARK 470     MET B 988    CG   SD   CE                                        
REMARK 470     GLU B 989    CG   CD   OE1  OE2                                  
REMARK 470     HIS B 990    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLU B 996    CG   CD   OE1  OE2                                  
REMARK 470     TYR B1057    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN B1061    CG   CD   OE1  NE2                                  
REMARK 470     LEU B1075    CG   CD1  CD2                                       
REMARK 470     PHE B1079    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE B1080    CG1  CG2  CD1                                       
REMARK 470     HIS B1084    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG B1090    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU B1116    CG   CD   OE1  OE2                                  
REMARK 470     ARG B1119    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS B1120    CG   CD   CE   NZ                                   
REMARK 470     ARG B1141    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU B1142    CG   CD   OE1  OE2                                  
REMARK 470     SER B1145    OG                                                  
REMARK 470     GLU B1146    CG   CD   OE1  OE2                                  
REMARK 470     GLU B1167    CG   CD   OE1  OE2                                  
REMARK 470     TYR B1168    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN B1170    CG   CD   OE1  NE2                                  
REMARK 470     ARG B1171    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU B1172    CG   CD1  CD2                                       
REMARK 470     LYS B1173    CG   CD   CE   NZ                                   
REMARK 470     GLU C 396    CG   CD   OE1  OE2                                  
REMARK 470     ASP C 407    CG   OD1  OD2                                       
REMARK 470     GLN C 410    CG   CD   OE1  NE2                                  
REMARK 470     GLU C 412    CG   CD   OE1  OE2                                  
REMARK 470     ARG C 415    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE C 418    CG1  CG2  CD1                                       
REMARK 470     TRP C 420    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP C 420    CZ3  CH2                                            
REMARK 470     ARG C 421    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE C 423    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS C 424    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU C 425    CG   CD1  CD2                                       
REMARK 470     GLU C 426    CG   CD   OE1  OE2                                  
REMARK 470     SER C 428    OG                                                  
REMARK 470     LEU C 429    CG   CD1  CD2                                       
REMARK 470     LEU C 433    CG   CD1  CD2                                       
REMARK 470     LEU C 434    CG   CD1  CD2                                       
REMARK 470     ASN C 435    CG   OD1  ND2                                       
REMARK 470     ASP C 436    CG   OD1  OD2                                       
REMARK 470     ARG C 437    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU C 444    CG   CD1  CD2                                       
REMARK 470     ILE C 445    CG1  CG2  CD1                                       
REMARK 470     LEU C 451    CG   CD1  CD2                                       
REMARK 470     PHE C 454    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU C 455    CG   CD1  CD2                                       
REMARK 470     THR C 456    OG1  CG2                                            
REMARK 470     PRO C 457    CG   CD                                             
REMARK 470     MET C 458    CG   SD   CE                                        
REMARK 470     ASN C 470    CG   OD1  ND2                                       
REMARK 470     LEU C 472    CG   CD1  CD2                                       
REMARK 470     ASP C 478    CG   OD1  OD2                                       
REMARK 470     GLN C 479    CG   CD   OE1  NE2                                  
REMARK 470     GLU C 535    CG   CD   OE1  OE2                                  
REMARK 470     MET C 537    CG   SD   CE                                        
REMARK 470     TYR C 538    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU C 539    CG   CD1  CD2                                       
REMARK 470     LYS C 543    CG   CD   CE   NZ                                   
REMARK 470     ASP C 561    CG   OD1  OD2                                       
REMARK 470     ASN C 570    CG   OD1  ND2                                       
REMARK 470     GLU C 608    CG   CD   OE1  OE2                                  
REMARK 470     ARG C 612    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP C 614    CG   OD1  OD2                                       
REMARK 470     MET C 622    CG   SD   CE                                        
REMARK 470     GLU C 629    CG   CD   OE1  OE2                                  
REMARK 470     GLU C 635    CG   CD   OE1  OE2                                  
REMARK 470     ASP C 651    CG   OD1  OD2                                       
REMARK 470     MET C 659    CG   SD   CE                                        
REMARK 470     GLN C 660    CG   CD   OE1  NE2                                  
REMARK 470     ASP C 662    CG   OD1  OD2                                       
REMARK 470     ASP C 683    CG   OD1  OD2                                       
REMARK 470     THR C 688    OG1  CG2                                            
REMARK 470     PHE C 698    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS C 699    SG                                                  
REMARK 470     PRO C 701    CG   CD                                             
REMARK 470     LEU C 702    CG   CD1  CD2                                       
REMARK 470     ILE C 703    CG1  CG2  CD1                                       
REMARK 470     THR C 705    OG1  CG2                                            
REMARK 470     LEU C 707    CG   CD1  CD2                                       
REMARK 470     ILE C 708    CG1  CG2  CD1                                       
REMARK 470     THR C 709    OG1  CG2                                            
REMARK 470     ARG C 711    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG C 770    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU C 814    CG   CD   OE1  OE2                                  
REMARK 470     LEU C 858    CG   CD1  CD2                                       
REMARK 470     ASP C 862    CG   OD1  OD2                                       
REMARK 470     THR C 873    OG1  CG2                                            
REMARK 470     LEU C 883    CG   CD1  CD2                                       
REMARK 470     LYS C 914    CG   CD   CE   NZ                                   
REMARK 470     GLN C 915    CG   CD   OE1  NE2                                  
REMARK 470     MET C 927    CG   SD   CE                                        
REMARK 470     ASP C 956    CG   OD1  OD2                                       
REMARK 470     GLU C 981    CG   CD   OE1  OE2                                  
REMARK 470     ASP C 982    CG   OD1  OD2                                       
REMARK 470     MET C 988    CG   SD   CE                                        
REMARK 470     GLU C 989    CG   CD   OE1  OE2                                  
REMARK 470     HIS C 990    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLU C 996    CG   CD   OE1  OE2                                  
REMARK 470     TYR C1057    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN C1061    CG   CD   OE1  NE2                                  
REMARK 470     LEU C1075    CG   CD1  CD2                                       
REMARK 470     PHE C1079    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE C1080    CG1  CG2  CD1                                       
REMARK 470     HIS C1084    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG C1090    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU C1116    CG   CD   OE1  OE2                                  
REMARK 470     ARG C1119    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS C1120    CG   CD   CE   NZ                                   
REMARK 470     ARG C1141    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU C1142    CG   CD   OE1  OE2                                  
REMARK 470     SER C1145    OG                                                  
REMARK 470     GLU C1146    CG   CD   OE1  OE2                                  
REMARK 470     GLU C1167    CG   CD   OE1  OE2                                  
REMARK 470     TYR C1168    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN C1170    CG   CD   OE1  NE2                                  
REMARK 470     ARG C1171    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU C1172    CG   CD1  CD2                                       
REMARK 470     LYS C1173    CG   CD   CE   NZ                                   
REMARK 470     GLU D 396    CG   CD   OE1  OE2                                  
REMARK 470     ASP D 407    CG   OD1  OD2                                       
REMARK 470     GLN D 410    CG   CD   OE1  NE2                                  
REMARK 470     GLU D 412    CG   CD   OE1  OE2                                  
REMARK 470     ARG D 415    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE D 418    CG1  CG2  CD1                                       
REMARK 470     TRP D 420    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP D 420    CZ3  CH2                                            
REMARK 470     ARG D 421    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     PHE D 423    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     HIS D 424    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LEU D 425    CG   CD1  CD2                                       
REMARK 470     GLU D 426    CG   CD   OE1  OE2                                  
REMARK 470     SER D 428    OG                                                  
REMARK 470     LEU D 429    CG   CD1  CD2                                       
REMARK 470     LEU D 433    CG   CD1  CD2                                       
REMARK 470     LEU D 434    CG   CD1  CD2                                       
REMARK 470     ASN D 435    CG   OD1  ND2                                       
REMARK 470     ASP D 436    CG   OD1  OD2                                       
REMARK 470     ARG D 437    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU D 444    CG   CD1  CD2                                       
REMARK 470     ILE D 445    CG1  CG2  CD1                                       
REMARK 470     LEU D 451    CG   CD1  CD2                                       
REMARK 470     PHE D 454    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU D 455    CG   CD1  CD2                                       
REMARK 470     THR D 456    OG1  CG2                                            
REMARK 470     PRO D 457    CG   CD                                             
REMARK 470     MET D 458    CG   SD   CE                                        
REMARK 470     ASN D 470    CG   OD1  ND2                                       
REMARK 470     LEU D 472    CG   CD1  CD2                                       
REMARK 470     ASP D 478    CG   OD1  OD2                                       
REMARK 470     GLN D 479    CG   CD   OE1  NE2                                  
REMARK 470     GLU D 535    CG   CD   OE1  OE2                                  
REMARK 470     MET D 537    CG   SD   CE                                        
REMARK 470     TYR D 538    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     LEU D 539    CG   CD1  CD2                                       
REMARK 470     LYS D 543    CG   CD   CE   NZ                                   
REMARK 470     ASP D 561    CG   OD1  OD2                                       
REMARK 470     ASN D 570    CG   OD1  ND2                                       
REMARK 470     GLU D 608    CG   CD   OE1  OE2                                  
REMARK 470     ARG D 612    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASP D 614    CG   OD1  OD2                                       
REMARK 470     MET D 622    CG   SD   CE                                        
REMARK 470     GLU D 629    CG   CD   OE1  OE2                                  
REMARK 470     GLU D 635    CG   CD   OE1  OE2                                  
REMARK 470     ASP D 651    CG   OD1  OD2                                       
REMARK 470     MET D 659    CG   SD   CE                                        
REMARK 470     GLN D 660    CG   CD   OE1  NE2                                  
REMARK 470     ASP D 662    CG   OD1  OD2                                       
REMARK 470     ASP D 683    CG   OD1  OD2                                       
REMARK 470     THR D 688    OG1  CG2                                            
REMARK 470     PHE D 698    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     CYS D 699    SG                                                  
REMARK 470     PRO D 701    CG   CD                                             
REMARK 470     LEU D 702    CG   CD1  CD2                                       
REMARK 470     ILE D 703    CG1  CG2  CD1                                       
REMARK 470     THR D 705    OG1  CG2                                            
REMARK 470     LEU D 707    CG   CD1  CD2                                       
REMARK 470     ILE D 708    CG1  CG2  CD1                                       
REMARK 470     THR D 709    OG1  CG2                                            
REMARK 470     ARG D 711    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ARG D 770    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU D 814    CG   CD   OE1  OE2                                  
REMARK 470     LEU D 858    CG   CD1  CD2                                       
REMARK 470     ASP D 862    CG   OD1  OD2                                       
REMARK 470     THR D 873    OG1  CG2                                            
REMARK 470     LEU D 883    CG   CD1  CD2                                       
REMARK 470     LYS D 914    CG   CD   CE   NZ                                   
REMARK 470     GLN D 915    CG   CD   OE1  NE2                                  
REMARK 470     MET D 927    CG   SD   CE                                        
REMARK 470     ASP D 956    CG   OD1  OD2                                       
REMARK 470     GLU D 981    CG   CD   OE1  OE2                                  
REMARK 470     ASP D 982    CG   OD1  OD2                                       
REMARK 470     MET D 988    CG   SD   CE                                        
REMARK 470     GLU D 989    CG   CD   OE1  OE2                                  
REMARK 470     GLU D 996    CG   CD   OE1  OE2                                  
REMARK 470     TYR D1057    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN D1061    CG   CD   OE1  NE2                                  
REMARK 470     LEU D1075    CG   CD1  CD2                                       
REMARK 470     PHE D1079    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ILE D1080    CG1  CG2  CD1                                       
REMARK 470     HIS D1084    CG   ND1  CD2  CE1  NE2                             
REMARK 470     ARG D1090    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU D1116    CG   CD   OE1  OE2                                  
REMARK 470     ARG D1119    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS D1120    CG   CD   CE   NZ                                   
REMARK 470     ARG D1141    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU D1142    CG   CD   OE1  OE2                                  
REMARK 470     SER D1145    OG                                                  
REMARK 470     GLU D1146    CG   CD   OE1  OE2                                  
REMARK 470     GLU D1167    CG   CD   OE1  OE2                                  
REMARK 470     TYR D1168    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLN D1170    CG   CD   OE1  NE2                                  
REMARK 470     ARG D1171    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LEU D1172    CG   CD1  CD2                                       
REMARK 470     LYS D1173    CG   CD   CE   NZ                                   
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   ND2  ASN B   992     O1   NAG B  1209              1.50            
REMARK 500   SG   CYS C   993     SG   CYS C  1011              1.51            
REMARK 500   SG   CYS D   993     SG   CYS D  1011              1.54            
REMARK 500   CG   ASN B   992     O1   NAG B  1209              1.75            
REMARK 500   OH   TYR B  1015     CAT  Y01 B  1205              1.79            
REMARK 500   OD1  ASN B   992     O1   NAG B  1209              1.86            
REMARK 500   O    PHE D   975     N    GLN D   977              1.92            
REMARK 500   ND2  ASN A   992     O1   NAG A  1210              1.92            
REMARK 500   OH   TYR A  1015     CAD  Y01 A  1205              1.94            
REMARK 500   CZ3  TRP B   864     CAT  Y01 B  1207              1.97            
REMARK 500   CE3  TRP B   864     CAR  Y01 B  1207              1.98            
REMARK 500   ND2  ASN D   992     O1   NAG D  1208              1.99            
REMARK 500   CZ3  TRP C   864     CAI  Y01 C  1205              2.07            
REMARK 500   CG   ASN A   992     O1   NAG A  1210              2.09            
REMARK 500   OH   TYR B  1015     CAR  Y01 B  1205              2.16            
REMARK 500   OD1  ASN B   913     OAF  Y01 B  1206              2.16            
REMARK 500   ND2  ASN B   992     C1   NAG B  1209              2.18            
REMARK 500   O    LEU D   972     O    GLN D   977              2.18            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500    LEU A1162   C     GLY A1163   N       0.252                       
REMARK 500    GLU A1169   C     GLN A1170   N       0.206                       
REMARK 500    LEU B1162   C     GLY B1163   N       0.224                       
REMARK 500    GLU B1169   C     GLN B1170   N       0.254                       
REMARK 500    GLU D1169   C     GLN D1170   N       0.191                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500    PRO A 438   CA  -  N   -  CD  ANGL. DEV. = -12.5 DEGREES          
REMARK 500    LEU A 590   CA  -  CB  -  CG  ANGL. DEV. =  14.2 DEGREES          
REMARK 500    PRO A 701   C   -  N   -  CA  ANGL. DEV. =  11.2 DEGREES          
REMARK 500    PRO A 701   N   -  CA  -  CB  ANGL. DEV. =  10.3 DEGREES          
REMARK 500    LEU A1162   CA  -  C   -  N   ANGL. DEV. =  14.6 DEGREES          
REMARK 500    LEU A1162   O   -  C   -  N   ANGL. DEV. = -14.3 DEGREES          
REMARK 500    GLY A1163   C   -  N   -  CA  ANGL. DEV. =  15.6 DEGREES          
REMARK 500    TYR A1168   O   -  C   -  N   ANGL. DEV. = -12.4 DEGREES          
REMARK 500    PRO B 438   CA  -  N   -  CD  ANGL. DEV. = -12.5 DEGREES          
REMARK 500    LEU B 590   CA  -  CB  -  CG  ANGL. DEV. =  14.2 DEGREES          
REMARK 500    PRO B 701   C   -  N   -  CA  ANGL. DEV. =  11.2 DEGREES          
REMARK 500    PRO B 701   N   -  CA  -  CB  ANGL. DEV. =  10.3 DEGREES          
REMARK 500    TYR B1168   O   -  C   -  N   ANGL. DEV. = -11.6 DEGREES          
REMARK 500    PRO C 438   CA  -  N   -  CD  ANGL. DEV. = -12.4 DEGREES          
REMARK 500    LEU C 590   CA  -  CB  -  CG  ANGL. DEV. =  14.2 DEGREES          
REMARK 500    PRO C 701   C   -  N   -  CA  ANGL. DEV. =  11.2 DEGREES          
REMARK 500    PRO C 701   N   -  CA  -  CB  ANGL. DEV. =  10.3 DEGREES          
REMARK 500    PRO D 438   CA  -  N   -  CD  ANGL. DEV. = -12.4 DEGREES          
REMARK 500    LEU D 590   CA  -  CB  -  CG  ANGL. DEV. =  14.2 DEGREES          
REMARK 500    PRO D 701   C   -  N   -  CA  ANGL. DEV. =  11.2 DEGREES          
REMARK 500    PRO D 701   N   -  CA  -  CB  ANGL. DEV. =  10.3 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    UNK A   3       35.82    -98.68                                   
REMARK 500    UNK A   8       30.65    -94.38                                   
REMARK 500    UNK A  95       -9.33     65.32                                   
REMARK 500    UNK A  96      136.95   -172.91                                   
REMARK 500    UNK A 107      -65.21   -121.98                                   
REMARK 500    UNK A 108      114.10   -165.60                                   
REMARK 500    UNK A 115       -8.63     70.75                                   
REMARK 500    UNK A 202      -71.52    -73.60                                   
REMARK 500    PHE A 454      -63.38    -99.76                                   
REMARK 500    MET A 458      -61.42    -99.01                                   
REMARK 500    LEU A 569       -7.49     69.74                                   
REMARK 500    LEU A 602       30.31    -95.99                                   
REMARK 500    GLU A 608       19.87     59.94                                   
REMARK 500    SER A 634      118.75   -168.28                                   
REMARK 500    MET A 659     -159.48    -91.80                                   
REMARK 500    ASP A 683       -6.00     68.52                                   
REMARK 500    PRO A 701       -3.70     73.64                                   
REMARK 500    ASP A 804     -155.79    -83.34                                   
REMARK 500    PHE A 805       11.13     81.44                                   
REMARK 500    SER A 812       -1.65     67.95                                   
REMARK 500    HIS A 889       -3.26     67.42                                   
REMARK 500    PHE A 910       30.12    -89.16                                   
REMARK 500    ARG A 953       85.80     50.68                                   
REMARK 500    PHE A 967      -13.05     72.49                                   
REMARK 500    TYR A 968      -50.27   -125.01                                   
REMARK 500    GLN A 980      -54.25     69.24                                   
REMARK 500    MET A 983     -146.18   -111.47                                   
REMARK 500    ASP A 984       68.63     36.46                                   
REMARK 500    HIS A1002       77.21     52.73                                   
REMARK 500    ALA A1074       72.33     62.62                                   
REMARK 500    PHE A1079     -163.97    -79.99                                   
REMARK 500    ALA A1137       32.28    -94.61                                   
REMARK 500    UNK B   3       35.86    -98.75                                   
REMARK 500    UNK B   8       30.80    -94.48                                   
REMARK 500    UNK B  95       -9.39     65.40                                   
REMARK 500    UNK B  96      136.97   -172.86                                   
REMARK 500    UNK B 107      -65.16   -121.96                                   
REMARK 500    UNK B 108      114.08   -165.64                                   
REMARK 500    UNK B 115       -8.68     70.72                                   
REMARK 500    UNK B 202      -71.50    -73.57                                   
REMARK 500    PHE B 454      -63.42    -99.78                                   
REMARK 500    MET B 458      -61.35    -99.07                                   
REMARK 500    LEU B 569       -7.48     69.71                                   
REMARK 500    LEU B 602       30.21    -95.97                                   
REMARK 500    GLU B 608       19.95     59.90                                   
REMARK 500    SER B 634      118.81   -168.49                                   
REMARK 500    MET B 659     -159.49    -91.89                                   
REMARK 500    ASP B 683       -6.05     68.55                                   
REMARK 500    PRO B 701       -3.60     73.58                                   
REMARK 500    ASP B 804     -155.84    -83.28                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     124 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 UNK A   93     UNK A   94                 -138.03                    
REMARK 500 ASN A  435     ASP A  436                 -147.46                    
REMARK 500 LEU A  567     LEU A  568                  149.95                    
REMARK 500 ALA A 1137     ARG A 1138                  148.33                    
REMARK 500 UNK B   93     UNK B   94                 -138.11                    
REMARK 500 ASN B  435     ASP B  436                 -147.47                    
REMARK 500 LEU B  567     LEU B  568                  149.97                    
REMARK 500 ALA B 1137     ARG B 1138                  148.29                    
REMARK 500 UNK C   93     UNK C   94                 -138.12                    
REMARK 500 ASN C  435     ASP C  436                 -147.39                    
REMARK 500 LEU C  567     LEU C  568                  149.97                    
REMARK 500 ALA C 1137     ARG C 1138                  148.33                    
REMARK 500 UNK D   93     UNK D   94                 -138.05                    
REMARK 500 ASN D  435     ASP D  436                 -147.47                    
REMARK 500 LEU D  567     LEU D  568                  149.98                    
REMARK 500 ALA D 1137     ARG D 1138                  148.30                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: PLANAR GROUPS                                              
REMARK 500                                                                      
REMARK 500 PLANAR GROUPS IN THE FOLLOWING RESIDUES HAVE A TOTAL                 
REMARK 500 RMS DISTANCE OF ALL ATOMS FROM THE BEST-FIT PLANE                    
REMARK 500 BY MORE THAN AN EXPECTED VALUE OF 6*RMSD, WITH AN                    
REMARK 500 RMSD 0.02 ANGSTROMS, OR AT LEAST ONE ATOM HAS                        
REMARK 500 AN RMSD GREATER THAN THIS VALUE                                      
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        RMS     TYPE                                    
REMARK 500    ARG A1067         0.10    SIDE CHAIN                              
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              NA A1202  NA                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 SER A1044   OG                                                     
REMARK 620 2 SER B1044   OG   70.9                                              
REMARK 620 3 SER C1044   OG  109.0  70.2                                        
REMARK 620 4 SER D1044   OG   69.3 108.7  70.4                                  
REMARK 620 N                    1     2     3                                   
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-7299   RELATED DB: EMDB                              
REMARK 900 3.7 ANGSTROM CRYOEM STRUCTURE OF FULL LENGTH HUMAN TRPM4             
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE FULL SAMPLE SEQUENCE IS                                          
REMARK 999 MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAMEDAFGAAVVTVWDSDA    
REMARK 999 HTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPAAVYSLVTRTWGFRAPNLVVSVLGGSGGPVL    
REMARK 999 QTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVR    
REMARK 999 NRDTLINPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTHGCLGGENRFRLRLESYISQQ    
REMARK 999 KTGVGGTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGG    
REMARK 999 ARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLKALVKACGSSEA    
REMARK 999 SAYLDELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFL    
REMARK 999 TPMRLAQLYSAAPSNSLIRNLLDQASHSAGTKAPALKGGAAELRPPDVGHVLRMLLGKMCAPRYP    
REMARK 999 SGGAWDPHPGQGFGESMYLLSDKATSPLSLDAGLGQAPWSDLLLWALLLNRAQMAMYFWEMGSNA    
REMARK 999 VSSALGACLLLRVMARLEPDAEEAARRKDLAFKFEGMGVDLFGECYRSSEVRAARLLLRRCPLWG    
REMARK 999 DATCLQLAMQADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCPPLIYTRLITFRKSEE    
REMARK 999 EPTREELEFDMDSVINGEGPVGTADPAEKTPLGVPRQSGRPGCCGGRCGGRRCLRRWFHFWGAPV    
REMARK 999 TIFMGNVVSYLLFLLLFSRVLLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSLASGGP    
REMARK 999 GPGHASLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFMVFTVRLLHIF    
REMARK 999 TVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEGLLRPRDSDFPSILRRVFYRPYLQIF    
REMARK 999 GQIPQEDMDVALMEHSNCSSEPGFWAHPPGAQAGTCVSQYANWLVVLLLVIFLLVANILLVNLLI    
REMARK 999 AMFSYTFGKVQGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSPQPSSPA    
REMARK 999 LEHFRVYLSKEAERKLLTWESVHKENFLLARARDKRESDSERLKRTSQKVDLALKQLGHIREYEQ    
REMARK 999 RLKVLE                                                               
DBREF  6BWI A    1  1176  PDB    6BWI     6BWI             1   1176             
DBREF  6BWI B    1  1176  PDB    6BWI     6BWI             1   1176             
DBREF  6BWI C    1  1176  PDB    6BWI     6BWI             1   1176             
DBREF  6BWI D    1  1176  PDB    6BWI     6BWI             1   1176             
SEQRES   1 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  12 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  13 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  14 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  15 A  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  16 A  977  ASP GLU LEU ARG LEU ALA VAL ALA TRP ASN ARG VAL ASP          
SEQRES  17 A  977  ILE ALA GLN SER GLU LEU PHE ARG GLY ASP ILE GLN TRP          
SEQRES  18 A  977  ARG SER PHE HIS LEU GLU ALA SER LEU MET ASP ALA LEU          
SEQRES  19 A  977  LEU ASN ASP ARG PRO GLU PHE VAL ARG LEU LEU ILE SER          
SEQRES  20 A  977  HIS GLY LEU SER LEU GLY HIS PHE LEU THR PRO MET ARG          
SEQRES  21 A  977  LEU ALA GLN LEU TYR SER ALA ALA PRO SER ASN SER LEU          
SEQRES  22 A  977  ILE ARG ASN LEU LEU ASP GLN ALA SER HIS SER ALA GLY          
SEQRES  23 A  977  THR LYS ALA PRO ALA LEU LYS GLY GLY ALA ALA GLU LEU          
SEQRES  24 A  977  ARG PRO PRO ASP VAL GLY HIS VAL LEU ARG MET LEU LEU          
SEQRES  25 A  977  GLY LYS MET CYS ALA PRO ARG TYR PRO SER GLY GLY ALA          
SEQRES  26 A  977  TRP ASP PRO HIS PRO GLY GLN GLY PHE GLY GLU SER MET          
SEQRES  27 A  977  TYR LEU LEU SER ASP LYS ALA THR SER PRO LEU SER LEU          
SEQRES  28 A  977  ASP ALA GLY LEU GLY GLN ALA PRO TRP SER ASP LEU LEU          
SEQRES  29 A  977  LEU TRP ALA LEU LEU LEU ASN ARG ALA GLN MET ALA MET          
SEQRES  30 A  977  TYR PHE TRP GLU MET GLY SER ASN ALA VAL SER SER ALA          
SEQRES  31 A  977  LEU GLY ALA CYS LEU LEU LEU ARG VAL MET ALA ARG LEU          
SEQRES  32 A  977  GLU PRO ASP ALA GLU GLU ALA ALA ARG ARG LYS ASP LEU          
SEQRES  33 A  977  ALA PHE LYS PHE GLU GLY MET GLY VAL ASP LEU PHE GLY          
SEQRES  34 A  977  GLU CYS TYR ARG SER SER GLU VAL ARG ALA ALA ARG LEU          
SEQRES  35 A  977  LEU LEU ARG ARG CYS PRO LEU TRP GLY ASP ALA THR CYS          
SEQRES  36 A  977  LEU GLN LEU ALA MET GLN ALA ASP ALA ARG ALA PHE PHE          
SEQRES  37 A  977  ALA GLN ASP GLY VAL GLN SER LEU LEU THR GLN LYS TRP          
SEQRES  38 A  977  TRP GLY ASP MET ALA SER THR THR PRO ILE TRP ALA LEU          
SEQRES  39 A  977  VAL LEU ALA PHE PHE CYS PRO PRO LEU ILE TYR THR ARG          
SEQRES  40 A  977  LEU ILE THR PHE ARG LYS SER GLU GLU GLU PRO THR ARG          
SEQRES  41 A  977  GLU GLU LEU GLU PHE ASP MET ASP SER VAL ILE ASN GLY          
SEQRES  42 A  977  GLU GLY PRO VAL GLY THR ALA ASP PRO ALA GLU LYS THR          
SEQRES  43 A  977  PRO LEU GLY VAL PRO ARG GLN SER GLY ARG PRO GLY CYS          
SEQRES  44 A  977  CYS GLY GLY ARG CYS GLY GLY ARG ARG CYS LEU ARG ARG          
SEQRES  45 A  977  TRP PHE HIS PHE TRP GLY ALA PRO VAL THR ILE PHE MET          
SEQRES  46 A  977  GLY ASN VAL VAL SER TYR LEU LEU PHE LEU LEU LEU PHE          
SEQRES  47 A  977  SER ARG VAL LEU LEU VAL ASP PHE GLN PRO ALA PRO PRO          
SEQRES  48 A  977  GLY SER LEU GLU LEU LEU LEU TYR PHE TRP ALA PHE THR          
SEQRES  49 A  977  LEU LEU CYS GLU GLU LEU ARG GLN GLY LEU SER GLY GLY          
SEQRES  50 A  977  GLY GLY SER LEU ALA SER GLY GLY PRO GLY PRO GLY HIS          
SEQRES  51 A  977  ALA SER LEU SER GLN ARG LEU ARG LEU TYR LEU ALA ASP          
SEQRES  52 A  977  SER TRP ASN GLN CYS ASP LEU VAL ALA LEU THR CYS PHE          
SEQRES  53 A  977  LEU LEU GLY VAL GLY CYS ARG LEU THR PRO GLY LEU TYR          
SEQRES  54 A  977  HIS LEU GLY ARG THR VAL LEU CYS ILE ASP PHE MET VAL          
SEQRES  55 A  977  PHE THR VAL ARG LEU LEU HIS ILE PHE THR VAL ASN LYS          
SEQRES  56 A  977  GLN LEU GLY PRO LYS ILE VAL ILE VAL SER LYS MET MET          
SEQRES  57 A  977  LYS ASP VAL PHE PHE PHE LEU PHE PHE LEU GLY VAL TRP          
SEQRES  58 A  977  LEU VAL ALA TYR GLY VAL ALA THR GLU GLY LEU LEU ARG          
SEQRES  59 A  977  PRO ARG ASP SER ASP PHE PRO SER ILE LEU ARG ARG VAL          
SEQRES  60 A  977  PHE TYR ARG PRO TYR LEU GLN ILE PHE GLY GLN ILE PRO          
SEQRES  61 A  977  GLN GLU ASP MET ASP VAL ALA LEU MET GLU HIS SER ASN          
SEQRES  62 A  977  CYS SER SER GLU PRO GLY PHE TRP ALA HIS PRO PRO GLY          
SEQRES  63 A  977  ALA GLN ALA GLY THR CYS VAL SER GLN TYR ALA ASN TRP          
SEQRES  64 A  977  LEU VAL VAL LEU LEU LEU VAL ILE PHE LEU LEU VAL ALA          
SEQRES  65 A  977  ASN ILE LEU LEU VAL ASN LEU LEU ILE ALA MET PHE SER          
SEQRES  66 A  977  TYR THR PHE GLY LYS VAL GLN GLY ASN SER ASP LEU TYR          
SEQRES  67 A  977  TRP LYS ALA GLN ARG TYR ARG LEU ILE ARG GLU PHE HIS          
SEQRES  68 A  977  SER ARG PRO ALA LEU ALA PRO PRO PHE ILE VAL ILE SER          
SEQRES  69 A  977  HIS LEU ARG LEU LEU LEU ARG GLN LEU CYS ARG ARG PRO          
SEQRES  70 A  977  ARG SER PRO GLN PRO SER SER PRO ALA LEU GLU HIS PHE          
SEQRES  71 A  977  ARG VAL TYR LEU SER LYS GLU ALA GLU ARG LYS LEU LEU          
SEQRES  72 A  977  THR TRP GLU SER VAL HIS LYS GLU ASN PHE LEU LEU ALA          
SEQRES  73 A  977  ARG ALA ARG ASP LYS ARG GLU SER ASP SER GLU ARG LEU          
SEQRES  74 A  977  LYS ARG THR SER GLN LYS VAL ASP LEU ALA LEU LYS GLN          
SEQRES  75 A  977  LEU GLY HIS ILE ARG GLU TYR GLU GLN ARG LEU LYS VAL          
SEQRES  76 A  977  LEU GLU                                                      
SEQRES   1 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  12 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  13 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  14 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  15 B  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  16 B  977  ASP GLU LEU ARG LEU ALA VAL ALA TRP ASN ARG VAL ASP          
SEQRES  17 B  977  ILE ALA GLN SER GLU LEU PHE ARG GLY ASP ILE GLN TRP          
SEQRES  18 B  977  ARG SER PHE HIS LEU GLU ALA SER LEU MET ASP ALA LEU          
SEQRES  19 B  977  LEU ASN ASP ARG PRO GLU PHE VAL ARG LEU LEU ILE SER          
SEQRES  20 B  977  HIS GLY LEU SER LEU GLY HIS PHE LEU THR PRO MET ARG          
SEQRES  21 B  977  LEU ALA GLN LEU TYR SER ALA ALA PRO SER ASN SER LEU          
SEQRES  22 B  977  ILE ARG ASN LEU LEU ASP GLN ALA SER HIS SER ALA GLY          
SEQRES  23 B  977  THR LYS ALA PRO ALA LEU LYS GLY GLY ALA ALA GLU LEU          
SEQRES  24 B  977  ARG PRO PRO ASP VAL GLY HIS VAL LEU ARG MET LEU LEU          
SEQRES  25 B  977  GLY LYS MET CYS ALA PRO ARG TYR PRO SER GLY GLY ALA          
SEQRES  26 B  977  TRP ASP PRO HIS PRO GLY GLN GLY PHE GLY GLU SER MET          
SEQRES  27 B  977  TYR LEU LEU SER ASP LYS ALA THR SER PRO LEU SER LEU          
SEQRES  28 B  977  ASP ALA GLY LEU GLY GLN ALA PRO TRP SER ASP LEU LEU          
SEQRES  29 B  977  LEU TRP ALA LEU LEU LEU ASN ARG ALA GLN MET ALA MET          
SEQRES  30 B  977  TYR PHE TRP GLU MET GLY SER ASN ALA VAL SER SER ALA          
SEQRES  31 B  977  LEU GLY ALA CYS LEU LEU LEU ARG VAL MET ALA ARG LEU          
SEQRES  32 B  977  GLU PRO ASP ALA GLU GLU ALA ALA ARG ARG LYS ASP LEU          
SEQRES  33 B  977  ALA PHE LYS PHE GLU GLY MET GLY VAL ASP LEU PHE GLY          
SEQRES  34 B  977  GLU CYS TYR ARG SER SER GLU VAL ARG ALA ALA ARG LEU          
SEQRES  35 B  977  LEU LEU ARG ARG CYS PRO LEU TRP GLY ASP ALA THR CYS          
SEQRES  36 B  977  LEU GLN LEU ALA MET GLN ALA ASP ALA ARG ALA PHE PHE          
SEQRES  37 B  977  ALA GLN ASP GLY VAL GLN SER LEU LEU THR GLN LYS TRP          
SEQRES  38 B  977  TRP GLY ASP MET ALA SER THR THR PRO ILE TRP ALA LEU          
SEQRES  39 B  977  VAL LEU ALA PHE PHE CYS PRO PRO LEU ILE TYR THR ARG          
SEQRES  40 B  977  LEU ILE THR PHE ARG LYS SER GLU GLU GLU PRO THR ARG          
SEQRES  41 B  977  GLU GLU LEU GLU PHE ASP MET ASP SER VAL ILE ASN GLY          
SEQRES  42 B  977  GLU GLY PRO VAL GLY THR ALA ASP PRO ALA GLU LYS THR          
SEQRES  43 B  977  PRO LEU GLY VAL PRO ARG GLN SER GLY ARG PRO GLY CYS          
SEQRES  44 B  977  CYS GLY GLY ARG CYS GLY GLY ARG ARG CYS LEU ARG ARG          
SEQRES  45 B  977  TRP PHE HIS PHE TRP GLY ALA PRO VAL THR ILE PHE MET          
SEQRES  46 B  977  GLY ASN VAL VAL SER TYR LEU LEU PHE LEU LEU LEU PHE          
SEQRES  47 B  977  SER ARG VAL LEU LEU VAL ASP PHE GLN PRO ALA PRO PRO          
SEQRES  48 B  977  GLY SER LEU GLU LEU LEU LEU TYR PHE TRP ALA PHE THR          
SEQRES  49 B  977  LEU LEU CYS GLU GLU LEU ARG GLN GLY LEU SER GLY GLY          
SEQRES  50 B  977  GLY GLY SER LEU ALA SER GLY GLY PRO GLY PRO GLY HIS          
SEQRES  51 B  977  ALA SER LEU SER GLN ARG LEU ARG LEU TYR LEU ALA ASP          
SEQRES  52 B  977  SER TRP ASN GLN CYS ASP LEU VAL ALA LEU THR CYS PHE          
SEQRES  53 B  977  LEU LEU GLY VAL GLY CYS ARG LEU THR PRO GLY LEU TYR          
SEQRES  54 B  977  HIS LEU GLY ARG THR VAL LEU CYS ILE ASP PHE MET VAL          
SEQRES  55 B  977  PHE THR VAL ARG LEU LEU HIS ILE PHE THR VAL ASN LYS          
SEQRES  56 B  977  GLN LEU GLY PRO LYS ILE VAL ILE VAL SER LYS MET MET          
SEQRES  57 B  977  LYS ASP VAL PHE PHE PHE LEU PHE PHE LEU GLY VAL TRP          
SEQRES  58 B  977  LEU VAL ALA TYR GLY VAL ALA THR GLU GLY LEU LEU ARG          
SEQRES  59 B  977  PRO ARG ASP SER ASP PHE PRO SER ILE LEU ARG ARG VAL          
SEQRES  60 B  977  PHE TYR ARG PRO TYR LEU GLN ILE PHE GLY GLN ILE PRO          
SEQRES  61 B  977  GLN GLU ASP MET ASP VAL ALA LEU MET GLU HIS SER ASN          
SEQRES  62 B  977  CYS SER SER GLU PRO GLY PHE TRP ALA HIS PRO PRO GLY          
SEQRES  63 B  977  ALA GLN ALA GLY THR CYS VAL SER GLN TYR ALA ASN TRP          
SEQRES  64 B  977  LEU VAL VAL LEU LEU LEU VAL ILE PHE LEU LEU VAL ALA          
SEQRES  65 B  977  ASN ILE LEU LEU VAL ASN LEU LEU ILE ALA MET PHE SER          
SEQRES  66 B  977  TYR THR PHE GLY LYS VAL GLN GLY ASN SER ASP LEU TYR          
SEQRES  67 B  977  TRP LYS ALA GLN ARG TYR ARG LEU ILE ARG GLU PHE HIS          
SEQRES  68 B  977  SER ARG PRO ALA LEU ALA PRO PRO PHE ILE VAL ILE SER          
SEQRES  69 B  977  HIS LEU ARG LEU LEU LEU ARG GLN LEU CYS ARG ARG PRO          
SEQRES  70 B  977  ARG SER PRO GLN PRO SER SER PRO ALA LEU GLU HIS PHE          
SEQRES  71 B  977  ARG VAL TYR LEU SER LYS GLU ALA GLU ARG LYS LEU LEU          
SEQRES  72 B  977  THR TRP GLU SER VAL HIS LYS GLU ASN PHE LEU LEU ALA          
SEQRES  73 B  977  ARG ALA ARG ASP LYS ARG GLU SER ASP SER GLU ARG LEU          
SEQRES  74 B  977  LYS ARG THR SER GLN LYS VAL ASP LEU ALA LEU LYS GLN          
SEQRES  75 B  977  LEU GLY HIS ILE ARG GLU TYR GLU GLN ARG LEU LYS VAL          
SEQRES  76 B  977  LEU GLU                                                      
SEQRES   1 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  12 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  13 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  14 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  15 C  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  16 C  977  ASP GLU LEU ARG LEU ALA VAL ALA TRP ASN ARG VAL ASP          
SEQRES  17 C  977  ILE ALA GLN SER GLU LEU PHE ARG GLY ASP ILE GLN TRP          
SEQRES  18 C  977  ARG SER PHE HIS LEU GLU ALA SER LEU MET ASP ALA LEU          
SEQRES  19 C  977  LEU ASN ASP ARG PRO GLU PHE VAL ARG LEU LEU ILE SER          
SEQRES  20 C  977  HIS GLY LEU SER LEU GLY HIS PHE LEU THR PRO MET ARG          
SEQRES  21 C  977  LEU ALA GLN LEU TYR SER ALA ALA PRO SER ASN SER LEU          
SEQRES  22 C  977  ILE ARG ASN LEU LEU ASP GLN ALA SER HIS SER ALA GLY          
SEQRES  23 C  977  THR LYS ALA PRO ALA LEU LYS GLY GLY ALA ALA GLU LEU          
SEQRES  24 C  977  ARG PRO PRO ASP VAL GLY HIS VAL LEU ARG MET LEU LEU          
SEQRES  25 C  977  GLY LYS MET CYS ALA PRO ARG TYR PRO SER GLY GLY ALA          
SEQRES  26 C  977  TRP ASP PRO HIS PRO GLY GLN GLY PHE GLY GLU SER MET          
SEQRES  27 C  977  TYR LEU LEU SER ASP LYS ALA THR SER PRO LEU SER LEU          
SEQRES  28 C  977  ASP ALA GLY LEU GLY GLN ALA PRO TRP SER ASP LEU LEU          
SEQRES  29 C  977  LEU TRP ALA LEU LEU LEU ASN ARG ALA GLN MET ALA MET          
SEQRES  30 C  977  TYR PHE TRP GLU MET GLY SER ASN ALA VAL SER SER ALA          
SEQRES  31 C  977  LEU GLY ALA CYS LEU LEU LEU ARG VAL MET ALA ARG LEU          
SEQRES  32 C  977  GLU PRO ASP ALA GLU GLU ALA ALA ARG ARG LYS ASP LEU          
SEQRES  33 C  977  ALA PHE LYS PHE GLU GLY MET GLY VAL ASP LEU PHE GLY          
SEQRES  34 C  977  GLU CYS TYR ARG SER SER GLU VAL ARG ALA ALA ARG LEU          
SEQRES  35 C  977  LEU LEU ARG ARG CYS PRO LEU TRP GLY ASP ALA THR CYS          
SEQRES  36 C  977  LEU GLN LEU ALA MET GLN ALA ASP ALA ARG ALA PHE PHE          
SEQRES  37 C  977  ALA GLN ASP GLY VAL GLN SER LEU LEU THR GLN LYS TRP          
SEQRES  38 C  977  TRP GLY ASP MET ALA SER THR THR PRO ILE TRP ALA LEU          
SEQRES  39 C  977  VAL LEU ALA PHE PHE CYS PRO PRO LEU ILE TYR THR ARG          
SEQRES  40 C  977  LEU ILE THR PHE ARG LYS SER GLU GLU GLU PRO THR ARG          
SEQRES  41 C  977  GLU GLU LEU GLU PHE ASP MET ASP SER VAL ILE ASN GLY          
SEQRES  42 C  977  GLU GLY PRO VAL GLY THR ALA ASP PRO ALA GLU LYS THR          
SEQRES  43 C  977  PRO LEU GLY VAL PRO ARG GLN SER GLY ARG PRO GLY CYS          
SEQRES  44 C  977  CYS GLY GLY ARG CYS GLY GLY ARG ARG CYS LEU ARG ARG          
SEQRES  45 C  977  TRP PHE HIS PHE TRP GLY ALA PRO VAL THR ILE PHE MET          
SEQRES  46 C  977  GLY ASN VAL VAL SER TYR LEU LEU PHE LEU LEU LEU PHE          
SEQRES  47 C  977  SER ARG VAL LEU LEU VAL ASP PHE GLN PRO ALA PRO PRO          
SEQRES  48 C  977  GLY SER LEU GLU LEU LEU LEU TYR PHE TRP ALA PHE THR          
SEQRES  49 C  977  LEU LEU CYS GLU GLU LEU ARG GLN GLY LEU SER GLY GLY          
SEQRES  50 C  977  GLY GLY SER LEU ALA SER GLY GLY PRO GLY PRO GLY HIS          
SEQRES  51 C  977  ALA SER LEU SER GLN ARG LEU ARG LEU TYR LEU ALA ASP          
SEQRES  52 C  977  SER TRP ASN GLN CYS ASP LEU VAL ALA LEU THR CYS PHE          
SEQRES  53 C  977  LEU LEU GLY VAL GLY CYS ARG LEU THR PRO GLY LEU TYR          
SEQRES  54 C  977  HIS LEU GLY ARG THR VAL LEU CYS ILE ASP PHE MET VAL          
SEQRES  55 C  977  PHE THR VAL ARG LEU LEU HIS ILE PHE THR VAL ASN LYS          
SEQRES  56 C  977  GLN LEU GLY PRO LYS ILE VAL ILE VAL SER LYS MET MET          
SEQRES  57 C  977  LYS ASP VAL PHE PHE PHE LEU PHE PHE LEU GLY VAL TRP          
SEQRES  58 C  977  LEU VAL ALA TYR GLY VAL ALA THR GLU GLY LEU LEU ARG          
SEQRES  59 C  977  PRO ARG ASP SER ASP PHE PRO SER ILE LEU ARG ARG VAL          
SEQRES  60 C  977  PHE TYR ARG PRO TYR LEU GLN ILE PHE GLY GLN ILE PRO          
SEQRES  61 C  977  GLN GLU ASP MET ASP VAL ALA LEU MET GLU HIS SER ASN          
SEQRES  62 C  977  CYS SER SER GLU PRO GLY PHE TRP ALA HIS PRO PRO GLY          
SEQRES  63 C  977  ALA GLN ALA GLY THR CYS VAL SER GLN TYR ALA ASN TRP          
SEQRES  64 C  977  LEU VAL VAL LEU LEU LEU VAL ILE PHE LEU LEU VAL ALA          
SEQRES  65 C  977  ASN ILE LEU LEU VAL ASN LEU LEU ILE ALA MET PHE SER          
SEQRES  66 C  977  TYR THR PHE GLY LYS VAL GLN GLY ASN SER ASP LEU TYR          
SEQRES  67 C  977  TRP LYS ALA GLN ARG TYR ARG LEU ILE ARG GLU PHE HIS          
SEQRES  68 C  977  SER ARG PRO ALA LEU ALA PRO PRO PHE ILE VAL ILE SER          
SEQRES  69 C  977  HIS LEU ARG LEU LEU LEU ARG GLN LEU CYS ARG ARG PRO          
SEQRES  70 C  977  ARG SER PRO GLN PRO SER SER PRO ALA LEU GLU HIS PHE          
SEQRES  71 C  977  ARG VAL TYR LEU SER LYS GLU ALA GLU ARG LYS LEU LEU          
SEQRES  72 C  977  THR TRP GLU SER VAL HIS LYS GLU ASN PHE LEU LEU ALA          
SEQRES  73 C  977  ARG ALA ARG ASP LYS ARG GLU SER ASP SER GLU ARG LEU          
SEQRES  74 C  977  LYS ARG THR SER GLN LYS VAL ASP LEU ALA LEU LYS GLN          
SEQRES  75 C  977  LEU GLY HIS ILE ARG GLU TYR GLU GLN ARG LEU LYS VAL          
SEQRES  76 C  977  LEU GLU                                                      
SEQRES   1 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  12 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  13 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  14 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  15 D  977  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  16 D  977  ASP GLU LEU ARG LEU ALA VAL ALA TRP ASN ARG VAL ASP          
SEQRES  17 D  977  ILE ALA GLN SER GLU LEU PHE ARG GLY ASP ILE GLN TRP          
SEQRES  18 D  977  ARG SER PHE HIS LEU GLU ALA SER LEU MET ASP ALA LEU          
SEQRES  19 D  977  LEU ASN ASP ARG PRO GLU PHE VAL ARG LEU LEU ILE SER          
SEQRES  20 D  977  HIS GLY LEU SER LEU GLY HIS PHE LEU THR PRO MET ARG          
SEQRES  21 D  977  LEU ALA GLN LEU TYR SER ALA ALA PRO SER ASN SER LEU          
SEQRES  22 D  977  ILE ARG ASN LEU LEU ASP GLN ALA SER HIS SER ALA GLY          
SEQRES  23 D  977  THR LYS ALA PRO ALA LEU LYS GLY GLY ALA ALA GLU LEU          
SEQRES  24 D  977  ARG PRO PRO ASP VAL GLY HIS VAL LEU ARG MET LEU LEU          
SEQRES  25 D  977  GLY LYS MET CYS ALA PRO ARG TYR PRO SER GLY GLY ALA          
SEQRES  26 D  977  TRP ASP PRO HIS PRO GLY GLN GLY PHE GLY GLU SER MET          
SEQRES  27 D  977  TYR LEU LEU SER ASP LYS ALA THR SER PRO LEU SER LEU          
SEQRES  28 D  977  ASP ALA GLY LEU GLY GLN ALA PRO TRP SER ASP LEU LEU          
SEQRES  29 D  977  LEU TRP ALA LEU LEU LEU ASN ARG ALA GLN MET ALA MET          
SEQRES  30 D  977  TYR PHE TRP GLU MET GLY SER ASN ALA VAL SER SER ALA          
SEQRES  31 D  977  LEU GLY ALA CYS LEU LEU LEU ARG VAL MET ALA ARG LEU          
SEQRES  32 D  977  GLU PRO ASP ALA GLU GLU ALA ALA ARG ARG LYS ASP LEU          
SEQRES  33 D  977  ALA PHE LYS PHE GLU GLY MET GLY VAL ASP LEU PHE GLY          
SEQRES  34 D  977  GLU CYS TYR ARG SER SER GLU VAL ARG ALA ALA ARG LEU          
SEQRES  35 D  977  LEU LEU ARG ARG CYS PRO LEU TRP GLY ASP ALA THR CYS          
SEQRES  36 D  977  LEU GLN LEU ALA MET GLN ALA ASP ALA ARG ALA PHE PHE          
SEQRES  37 D  977  ALA GLN ASP GLY VAL GLN SER LEU LEU THR GLN LYS TRP          
SEQRES  38 D  977  TRP GLY ASP MET ALA SER THR THR PRO ILE TRP ALA LEU          
SEQRES  39 D  977  VAL LEU ALA PHE PHE CYS PRO PRO LEU ILE TYR THR ARG          
SEQRES  40 D  977  LEU ILE THR PHE ARG LYS SER GLU GLU GLU PRO THR ARG          
SEQRES  41 D  977  GLU GLU LEU GLU PHE ASP MET ASP SER VAL ILE ASN GLY          
SEQRES  42 D  977  GLU GLY PRO VAL GLY THR ALA ASP PRO ALA GLU LYS THR          
SEQRES  43 D  977  PRO LEU GLY VAL PRO ARG GLN SER GLY ARG PRO GLY CYS          
SEQRES  44 D  977  CYS GLY GLY ARG CYS GLY GLY ARG ARG CYS LEU ARG ARG          
SEQRES  45 D  977  TRP PHE HIS PHE TRP GLY ALA PRO VAL THR ILE PHE MET          
SEQRES  46 D  977  GLY ASN VAL VAL SER TYR LEU LEU PHE LEU LEU LEU PHE          
SEQRES  47 D  977  SER ARG VAL LEU LEU VAL ASP PHE GLN PRO ALA PRO PRO          
SEQRES  48 D  977  GLY SER LEU GLU LEU LEU LEU TYR PHE TRP ALA PHE THR          
SEQRES  49 D  977  LEU LEU CYS GLU GLU LEU ARG GLN GLY LEU SER GLY GLY          
SEQRES  50 D  977  GLY GLY SER LEU ALA SER GLY GLY PRO GLY PRO GLY HIS          
SEQRES  51 D  977  ALA SER LEU SER GLN ARG LEU ARG LEU TYR LEU ALA ASP          
SEQRES  52 D  977  SER TRP ASN GLN CYS ASP LEU VAL ALA LEU THR CYS PHE          
SEQRES  53 D  977  LEU LEU GLY VAL GLY CYS ARG LEU THR PRO GLY LEU TYR          
SEQRES  54 D  977  HIS LEU GLY ARG THR VAL LEU CYS ILE ASP PHE MET VAL          
SEQRES  55 D  977  PHE THR VAL ARG LEU LEU HIS ILE PHE THR VAL ASN LYS          
SEQRES  56 D  977  GLN LEU GLY PRO LYS ILE VAL ILE VAL SER LYS MET MET          
SEQRES  57 D  977  LYS ASP VAL PHE PHE PHE LEU PHE PHE LEU GLY VAL TRP          
SEQRES  58 D  977  LEU VAL ALA TYR GLY VAL ALA THR GLU GLY LEU LEU ARG          
SEQRES  59 D  977  PRO ARG ASP SER ASP PHE PRO SER ILE LEU ARG ARG VAL          
SEQRES  60 D  977  PHE TYR ARG PRO TYR LEU GLN ILE PHE GLY GLN ILE PRO          
SEQRES  61 D  977  GLN GLU ASP MET ASP VAL ALA LEU MET GLU HIS SER ASN          
SEQRES  62 D  977  CYS SER SER GLU PRO GLY PHE TRP ALA HIS PRO PRO GLY          
SEQRES  63 D  977  ALA GLN ALA GLY THR CYS VAL SER GLN TYR ALA ASN TRP          
SEQRES  64 D  977  LEU VAL VAL LEU LEU LEU VAL ILE PHE LEU LEU VAL ALA          
SEQRES  65 D  977  ASN ILE LEU LEU VAL ASN LEU LEU ILE ALA MET PHE SER          
SEQRES  66 D  977  TYR THR PHE GLY LYS VAL GLN GLY ASN SER ASP LEU TYR          
SEQRES  67 D  977  TRP LYS ALA GLN ARG TYR ARG LEU ILE ARG GLU PHE HIS          
SEQRES  68 D  977  SER ARG PRO ALA LEU ALA PRO PRO PHE ILE VAL ILE SER          
SEQRES  69 D  977  HIS LEU ARG LEU LEU LEU ARG GLN LEU CYS ARG ARG PRO          
SEQRES  70 D  977  ARG SER PRO GLN PRO SER SER PRO ALA LEU GLU HIS PHE          
SEQRES  71 D  977  ARG VAL TYR LEU SER LYS GLU ALA GLU ARG LYS LEU LEU          
SEQRES  72 D  977  THR TRP GLU SER VAL HIS LYS GLU ASN PHE LEU LEU ALA          
SEQRES  73 D  977  ARG ALA ARG ASP LYS ARG GLU SER ASP SER GLU ARG LEU          
SEQRES  74 D  977  LYS ARG THR SER GLN LYS VAL ASP LEU ALA LEU LYS GLN          
SEQRES  75 D  977  LEU GLY HIS ILE ARG GLU TYR GLU GLN ARG LEU LYS VAL          
SEQRES  76 D  977  LEU GLU                                                      
HET     NA  A1201       1                                                       
HET     NA  A1202       1                                                       
HET     NA  A1203       1                                                       
HET    Y01  A1204      35                                                       
HET    Y01  A1205      35                                                       
HET    Y01  A1206      35                                                       
HET    Y01  A1207      35                                                       
HET    Y01  A1208      35                                                       
HET    Y01  A1209      35                                                       
HET    NAG  A1210      15                                                       
HET     NA  B1201       1                                                       
HET     NA  B1202       1                                                       
HET    Y01  B1203      35                                                       
HET    Y01  B1204      35                                                       
HET    Y01  B1205      35                                                       
HET    Y01  B1206      35                                                       
HET    Y01  B1207      35                                                       
HET    Y01  B1208      35                                                       
HET    NAG  B1209      15                                                       
HET    Y01  C1201      35                                                       
HET    Y01  C1202      35                                                       
HET    Y01  C1203      35                                                       
HET    Y01  C1204      35                                                       
HET    Y01  C1205      35                                                       
HET    NAG  C1206      15                                                       
HET    Y01  D1201      35                                                       
HET    Y01  D1202      35                                                       
HET    Y01  D1203      35                                                       
HET    Y01  D1204      35                                                       
HET    Y01  D1205      35                                                       
HET    Y01  D1206      35                                                       
HET    Y01  D1207      35                                                       
HET    NAG  D1208      15                                                       
HETNAM      NA SODIUM ION                                                       
HETNAM     Y01 CHOLESTEROL HEMISUCCINATE                                        
HETNAM     NAG 2-ACETAMIDO-2-DEOXY-BETA-D-GLUCOPYRANOSE                         
FORMUL   5   NA    5(NA 1+)                                                     
FORMUL   8  Y01    24(C31 H50 O4)                                               
FORMUL  14  NAG    4(C8 H15 N O6)                                               
HELIX    1 AA1 UNK A    5  UNK A    9  5                                   5    
HELIX    2 AA2 UNK A   13  UNK A   26  1                                  14    
HELIX    3 AA3 UNK A   32  UNK A   44  1                                  13    
HELIX    4 AA4 UNK A   53  UNK A   62  1                                  10    
HELIX    5 AA5 UNK A   74  UNK A   86  1                                  13    
HELIX    6 AA6 UNK A  204  UNK A  210  1                                   7    
HELIX    7 AA7 UNK A  212  UNK A  217  1                                   6    
HELIX    8 AA8 UNK A  228  UNK A  234  1                                   7    
HELIX    9 AA9 UNK A  237  UNK A  242  1                                   6    
HELIX   10 AB1 UNK A  261  UNK A  276  1                                  16    
HELIX   11 AB2 GLU A  396  TRP A  403  1                                   8    
HELIX   12 AB3 ARG A  405  GLU A  412  1                                   8    
HELIX   13 AB4 ARG A  421  ALA A  432  1                                  12    
HELIX   14 AB5 ASP A  436  PHE A  440  5                                   5    
HELIX   15 AB6 MET A  458  SER A  465  1                                   8    
HELIX   16 AB7 ILE A  473  GLN A  479  1                                   7    
HELIX   17 AB8 MET A  537  ALA A  544  1                                   8    
HELIX   18 AB9 SER A  560  LEU A  568  1                                   9    
HELIX   19 AC1 ARG A  571  MET A  581  1                                  11    
HELIX   20 AC2 ASN A  584  GLY A  591  1                                   8    
HELIX   21 AC3 LEU A  595  LEU A  602  1                                   8    
HELIX   22 AC4 ALA A  610  SER A  634  1                                  25    
HELIX   23 AC5 SER A  634  LEU A  643  1                                  10    
HELIX   24 AC6 ALA A  652  ALA A  658  1                                   7    
HELIX   25 AC7 ALA A  663  ALA A  668  1                                   6    
HELIX   26 AC8 VAL A  672  TRP A  681  1                                  10    
HELIX   27 AC9 PRO A  689  LEU A  695  1                                   7    
HELIX   28 AD1 PHE A  698  ILE A  703  1                                   6    
HELIX   29 AD2 CYS A  768  ARG A  770  5                                   3    
HELIX   30 AD3 ARG A  771  TRP A  776  1                                   6    
HELIX   31 AD4 VAL A  780  VAL A  803  1                                  24    
HELIX   32 AD5 GLU A  814  GLY A  832  1                                  19    
HELIX   33 AD6 SER A  853  LEU A  860  1                                   8    
HELIX   34 AD7 GLN A  866  THR A  884  1                                  19    
HELIX   35 AD8 LEU A  890  PHE A  910  1                                  21    
HELIX   36 AD9 GLY A  917  MET A  926  1                                  10    
HELIX   37 AE1 MET A  926  LEU A  952  1                                  27    
HELIX   38 AE2 ASP A  958  VAL A  966  1                                   9    
HELIX   39 AE3 ASN A 1017  ALA A 1031  1                                  15    
HELIX   40 AE4 LEU A 1035  GLU A 1068  1                                  34    
HELIX   41 AE5 VAL A 1081  ARG A 1090  1                                  10    
HELIX   42 AE6 GLU A 1116  ALA A 1137  1                                  22    
HELIX   43 AE7 SER A 1145  LEU A 1172  1                                  28    
HELIX   44 AE8 UNK B    5  UNK B    9  5                                   5    
HELIX   45 AE9 UNK B   13  UNK B   26  1                                  14    
HELIX   46 AF1 UNK B   32  UNK B   44  1                                  13    
HELIX   47 AF2 UNK B   53  UNK B   62  1                                  10    
HELIX   48 AF3 UNK B   74  UNK B   86  1                                  13    
HELIX   49 AF4 UNK B  204  UNK B  210  1                                   7    
HELIX   50 AF5 UNK B  212  UNK B  217  1                                   6    
HELIX   51 AF6 UNK B  228  UNK B  234  1                                   7    
HELIX   52 AF7 UNK B  237  UNK B  242  1                                   6    
HELIX   53 AF8 UNK B  261  UNK B  276  1                                  16    
HELIX   54 AF9 GLU B  396  TRP B  403  1                                   8    
HELIX   55 AG1 ARG B  405  GLU B  412  1                                   8    
HELIX   56 AG2 ARG B  421  ALA B  432  1                                  12    
HELIX   57 AG3 ASP B  436  PHE B  440  5                                   5    
HELIX   58 AG4 MET B  458  SER B  465  1                                   8    
HELIX   59 AG5 ILE B  473  GLN B  479  1                                   7    
HELIX   60 AG6 MET B  537  ALA B  544  1                                   8    
HELIX   61 AG7 SER B  560  LEU B  568  1                                   9    
HELIX   62 AG8 ARG B  571  MET B  581  1                                  11    
HELIX   63 AG9 ALA B  585  GLY B  591  1                                   7    
HELIX   64 AH1 LEU B  595  LEU B  602  1                                   8    
HELIX   65 AH2 ALA B  610  SER B  634  1                                  25    
HELIX   66 AH3 SER B  634  LEU B  643  1                                  10    
HELIX   67 AH4 ALA B  652  ALA B  658  1                                   7    
HELIX   68 AH5 ALA B  663  ALA B  668  1                                   6    
HELIX   69 AH6 VAL B  672  TRP B  681  1                                  10    
HELIX   70 AH7 PRO B  689  LEU B  695  1                                   7    
HELIX   71 AH8 PHE B  698  ILE B  703  1                                   6    
HELIX   72 AH9 CYS B  768  ARG B  770  5                                   3    
HELIX   73 AI1 ARG B  771  TRP B  776  1                                   6    
HELIX   74 AI2 VAL B  780  VAL B  803  1                                  24    
HELIX   75 AI3 GLU B  814  GLY B  832  1                                  19    
HELIX   76 AI4 GLN B  854  LEU B  860  1                                   7    
HELIX   77 AI5 GLN B  866  THR B  884  1                                  19    
HELIX   78 AI6 LEU B  890  PHE B  910  1                                  21    
HELIX   79 AI7 GLY B  917  MET B  926  1                                  10    
HELIX   80 AI8 MET B  926  LEU B  952  1                                  27    
HELIX   81 AI9 ASP B  958  VAL B  966  1                                   9    
HELIX   82 AJ1 ASN B 1017  LEU B 1034  1                                  18    
HELIX   83 AJ2 LEU B 1035  PHE B 1069  1                                  35    
HELIX   84 AJ3 VAL B 1081  ARG B 1090  1                                  10    
HELIX   85 AJ4 GLU B 1116  ALA B 1137  1                                  22    
HELIX   86 AJ5 SER B 1145  LEU B 1172  1                                  28    
HELIX   87 AJ6 UNK C    5  UNK C    9  5                                   5    
HELIX   88 AJ7 UNK C   13  UNK C   26  1                                  14    
HELIX   89 AJ8 UNK C   32  UNK C   44  1                                  13    
HELIX   90 AJ9 UNK C   53  UNK C   62  1                                  10    
HELIX   91 AK1 UNK C   74  UNK C   86  1                                  13    
HELIX   92 AK2 UNK C  204  UNK C  210  1                                   7    
HELIX   93 AK3 UNK C  212  UNK C  217  1                                   6    
HELIX   94 AK4 UNK C  228  UNK C  234  1                                   7    
HELIX   95 AK5 UNK C  237  UNK C  242  1                                   6    
HELIX   96 AK6 UNK C  261  UNK C  276  1                                  16    
HELIX   97 AK7 GLU C  396  TRP C  403  1                                   8    
HELIX   98 AK8 ARG C  405  GLU C  412  1                                   8    
HELIX   99 AK9 ARG C  421  ALA C  432  1                                  12    
HELIX  100 AL1 ASP C  436  PHE C  440  5                                   5    
HELIX  101 AL2 MET C  458  SER C  465  1                                   8    
HELIX  102 AL3 ILE C  473  GLN C  479  1                                   7    
HELIX  103 AL4 MET C  537  ALA C  544  1                                   8    
HELIX  104 AL5 SER C  560  LEU C  568  1                                   9    
HELIX  105 AL6 ARG C  571  MET C  581  1                                  11    
HELIX  106 AL7 ALA C  585  GLY C  591  1                                   7    
HELIX  107 AL8 LEU C  595  LEU C  602  1                                   8    
HELIX  108 AL9 ALA C  610  SER C  634  1                                  25    
HELIX  109 AM1 SER C  634  LEU C  643  1                                  10    
HELIX  110 AM2 ALA C  652  ALA C  658  1                                   7    
HELIX  111 AM3 ALA C  663  ALA C  668  1                                   6    
HELIX  112 AM4 VAL C  672  TRP C  681  1                                  10    
HELIX  113 AM5 PRO C  689  LEU C  695  1                                   7    
HELIX  114 AM6 PHE C  698  ILE C  703  1                                   6    
HELIX  115 AM7 CYS C  768  ARG C  770  5                                   3    
HELIX  116 AM8 ARG C  771  TRP C  776  1                                   6    
HELIX  117 AM9 VAL C  780  VAL C  803  1                                  24    
HELIX  118 AN1 GLU C  814  GLY C  832  1                                  19    
HELIX  119 AN2 GLN C  854  LEU C  860  1                                   7    
HELIX  120 AN3 GLN C  866  THR C  884  1                                  19    
HELIX  121 AN4 LEU C  890  PHE C  910  1                                  21    
HELIX  122 AN5 GLY C  917  MET C  926  1                                  10    
HELIX  123 AN6 MET C  926  LEU C  952  1                                  27    
HELIX  124 AN7 ASP C  958  VAL C  966  1                                   9    
HELIX  125 AN8 ASN C 1017  LEU C 1034  1                                  18    
HELIX  126 AN9 LEU C 1035  GLU C 1068  1                                  34    
HELIX  127 AO1 VAL C 1081  ARG C 1090  1                                  10    
HELIX  128 AO2 GLU C 1116  ALA C 1137  1                                  22    
HELIX  129 AO3 SER C 1145  LEU C 1172  1                                  28    
HELIX  130 AO4 UNK D    5  UNK D    9  5                                   5    
HELIX  131 AO5 UNK D   13  UNK D   26  1                                  14    
HELIX  132 AO6 UNK D   32  UNK D   44  1                                  13    
HELIX  133 AO7 UNK D   53  UNK D   62  1                                  10    
HELIX  134 AO8 UNK D   74  UNK D   86  1                                  13    
HELIX  135 AO9 UNK D  204  UNK D  210  1                                   7    
HELIX  136 AP1 UNK D  212  UNK D  217  1                                   6    
HELIX  137 AP2 UNK D  228  UNK D  234  1                                   7    
HELIX  138 AP3 UNK D  237  UNK D  242  1                                   6    
HELIX  139 AP4 UNK D  261  UNK D  276  1                                  16    
HELIX  140 AP5 GLU D  396  TRP D  403  1                                   8    
HELIX  141 AP6 ARG D  405  GLU D  412  1                                   8    
HELIX  142 AP7 ARG D  421  ALA D  432  1                                  12    
HELIX  143 AP8 ASP D  436  PHE D  440  5                                   5    
HELIX  144 AP9 MET D  458  SER D  465  1                                   8    
HELIX  145 AQ1 ILE D  473  GLN D  479  1                                   7    
HELIX  146 AQ2 MET D  537  ALA D  544  1                                   8    
HELIX  147 AQ3 SER D  560  LEU D  568  1                                   9    
HELIX  148 AQ4 ARG D  571  MET D  581  1                                  11    
HELIX  149 AQ5 ALA D  585  GLY D  591  1                                   7    
HELIX  150 AQ6 LEU D  595  LEU D  602  1                                   8    
HELIX  151 AQ7 ALA D  610  SER D  634  1                                  25    
HELIX  152 AQ8 SER D  634  LEU D  643  1                                  10    
HELIX  153 AQ9 ALA D  652  ALA D  658  1                                   7    
HELIX  154 AR1 ALA D  663  ALA D  668  1                                   6    
HELIX  155 AR2 VAL D  672  TRP D  681  1                                  10    
HELIX  156 AR3 PRO D  689  LEU D  695  1                                   7    
HELIX  157 AR4 PHE D  698  ILE D  703  1                                   6    
HELIX  158 AR5 CYS D  768  ARG D  770  5                                   3    
HELIX  159 AR6 ARG D  771  TRP D  776  1                                   6    
HELIX  160 AR7 VAL D  780  VAL D  803  1                                  24    
HELIX  161 AR8 GLU D  814  GLY D  832  1                                  19    
HELIX  162 AR9 GLN D  854  LEU D  860  1                                   7    
HELIX  163 AS1 GLN D  866  THR D  884  1                                  19    
HELIX  164 AS2 LEU D  890  PHE D  910  1                                  21    
HELIX  165 AS3 GLY D  917  MET D  926  1                                  10    
HELIX  166 AS4 MET D  926  LEU D  952  1                                  27    
HELIX  167 AS5 ASP D  958  VAL D  966  1                                   9    
HELIX  168 AS6 ASN D 1017  LEU D 1034  1                                  18    
HELIX  169 AS7 LEU D 1035  GLU D 1068  1                                  34    
HELIX  170 AS8 VAL D 1081  ARG D 1090  1                                  10    
HELIX  171 AS9 GLU D 1116  ALA D 1137  1                                  22    
HELIX  172 AT1 SER D 1145  LEU D 1172  1                                  28    
SHEET    1 AA1 2 UNK A 101  UNK A 103  0                                        
SHEET    2 AA1 2 UNK A 109  UNK A 111 -1  O  UNK A 111   N  UNK A 101           
SHEET    1 AA2 2 PHE A 999  TRP A1000  0                                        
SHEET    2 AA2 2 SER A1013  GLN A1014 -1  O  GLN A1014   N  PHE A 999           
SHEET    1 AA3 2 UNK B 101  UNK B 103  0                                        
SHEET    2 AA3 2 UNK B 109  UNK B 111 -1  O  UNK B 111   N  UNK B 101           
SHEET    1 AA4 2 PHE B 999  TRP B1000  0                                        
SHEET    2 AA4 2 SER B1013  GLN B1014 -1  O  GLN B1014   N  PHE B 999           
SHEET    1 AA5 2 UNK C 101  UNK C 103  0                                        
SHEET    2 AA5 2 UNK C 109  UNK C 111 -1  O  UNK C 111   N  UNK C 101           
SHEET    1 AA6 2 PHE C 999  TRP C1000  0                                        
SHEET    2 AA6 2 SER C1013  GLN C1014 -1  O  GLN C1014   N  PHE C 999           
SHEET    1 AA7 2 UNK D 101  UNK D 103  0                                        
SHEET    2 AA7 2 UNK D 109  UNK D 111 -1  O  UNK D 111   N  UNK D 101           
SHEET    1 AA8 2 PHE D 999  TRP D1000  0                                        
SHEET    2 AA8 2 SER D1013  GLN D1014 -1  O  GLN D1014   N  PHE D 999           
SSBOND   1 CYS A  993    CYS A 1011                          1555   1555  2.18  
SSBOND   2 CYS B  993    CYS B 1011                          1555   1555  1.89  
LINK         CB  CYS A 993                 SG  CYS A1011     1555   1555  1.97  
LINK         CB  CYS B 993                 SG  CYS B1011     1555   1555  1.77  
LINK         CB  CYS C 993                 SG  CYS C1011     1555   1555  1.81  
LINK         CB  CYS D 993                 SG  CYS D1011     1555   1555  2.00  
LINK         OG  SER A1044                NA    NA A1202     1555   1555  3.09  
LINK        NA    NA A1202                 OG  SER B1044     1555   1555  3.06  
LINK        NA    NA A1202                 OG  SER C1044     1555   1555  3.07  
LINK        NA    NA A1202                 OG  SER D1044     1555   1555  3.08  
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      1.000000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  1.000000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  1.000000        0.00000                         
(ATOM LINES ARE NOT SHOWN.)
END                                                                             
DBGET integrated database retrieval system