GenomeNet

Database: PDB
Entry: 6C24
LinkDB: 6C24
Original site: 6C24 
HEADER    GENE REGULATION                         06-JAN-18   6C24              
TITLE     CRYO-EM STRUCTURE OF PRC2 BOUND TO COFACTORS AEBP2 AND JARID2 IN THE  
TITLE    2 EXTENDED ACTIVE STATE                                                
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: POLYCOMB PROTEIN SUZ12;                                    
COMPND   3 CHAIN: A, M, Q;                                                      
COMPND   4 SYNONYM: CHROMATIN PRECIPITATED E2F TARGET 9 PROTEIN,CHET 9 PROTEIN, 
COMPND   5 JOINED TO JAZF1 PROTEIN,SUPPRESSOR OF ZESTE 12 PROTEIN HOMOLOG;      
COMPND   6 ENGINEERED: YES;                                                     
COMPND   7 MOL_ID: 2;                                                           
COMPND   8 MOLECULE: PROTEIN JUMONJI;                                           
COMPND   9 CHAIN: B;                                                            
COMPND  10 SYNONYM: JUMONJI/ARID DOMAIN-CONTAINING PROTEIN 2;                   
COMPND  11 ENGINEERED: YES;                                                     
COMPND  12 MOL_ID: 3;                                                           
COMPND  13 MOLECULE: PROTEIN JUMONJI;                                           
COMPND  14 CHAIN: E;                                                            
COMPND  15 SYNONYM: JUMONJI/ARID DOMAIN-CONTAINING PROTEIN 2;                   
COMPND  16 ENGINEERED: YES;                                                     
COMPND  17 MOL_ID: 4;                                                           
COMPND  18 MOLECULE: HISTONE-LYSINE N-METHYLTRANSFERASE EZH2;                   
COMPND  19 CHAIN: K, C;                                                         
COMPND  20 SYNONYM: ENX-1,ENHANCER OF ZESTE HOMOLOG 2,LYSINE N-METHYLTRANSFERASE
COMPND  21 6;                                                                   
COMPND  22 EC: 2.1.1.43;                                                        
COMPND  23 ENGINEERED: YES;                                                     
COMPND  24 MOL_ID: 5;                                                           
COMPND  25 MOLECULE: POLYCOMB PROTEIN EED;                                      
COMPND  26 CHAIN: L;                                                            
COMPND  27 SYNONYM: HEED,EMBRYONIC ECTODERM DEVELOPMENT PROTEIN,WD PROTEIN      
COMPND  28 ASSOCIATING WITH INTEGRIN CYTOPLASMIC TAILS 1,WAIT-1;                
COMPND  29 ENGINEERED: YES;                                                     
COMPND  30 MOL_ID: 6;                                                           
COMPND  31 MOLECULE: HISTONE-BINDING PROTEIN RBBP4;                             
COMPND  32 CHAIN: N;                                                            
COMPND  33 SYNONYM: CHROMATIN ASSEMBLY FACTOR 1 SUBUNIT C,CAF-1 SUBUNIT C,      
COMPND  34 CHROMATIN ASSEMBLY FACTOR I P48 SUBUNIT,CAF-I P48,NUCLEOSOME-        
COMPND  35 REMODELING FACTOR SUBUNIT RBAP48,RETINOBLASTOMA-BINDING PROTEIN 4,   
COMPND  36 RBBP-4,RETINOBLASTOMA-BINDING PROTEIN P48;                           
COMPND  37 ENGINEERED: YES;                                                     
COMPND  38 MOL_ID: 7;                                                           
COMPND  39 MOLECULE: JARID2-SUBSTRATE;                                          
COMPND  40 CHAIN: O;                                                            
COMPND  41 ENGINEERED: YES;                                                     
COMPND  42 MOL_ID: 8;                                                           
COMPND  43 MOLECULE: ZINC FINGER PROTEIN AEBP2;                                 
COMPND  44 CHAIN: P;                                                            
COMPND  45 SYNONYM: ADIPOCYTE ENHANCER-BINDING PROTEIN 2,AE-BINDING PROTEIN 2;  
COMPND  46 ENGINEERED: YES;                                                     
COMPND  47 MOL_ID: 9;                                                           
COMPND  48 MOLECULE: SUZ12;                                                     
COMPND  49 CHAIN: Z;                                                            
COMPND  50 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: SUZ12, CHET9, JJAZ1, KIAA0160;                                 
SOURCE   6 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE   7 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE   8 MOL_ID: 2;                                                           
SOURCE   9 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  10 ORGANISM_COMMON: HUMAN;                                              
SOURCE  11 ORGANISM_TAXID: 9606;                                                
SOURCE  12 GENE: JARID2, JMJ;                                                   
SOURCE  13 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  14 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  15 MOL_ID: 3;                                                           
SOURCE  16 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  17 ORGANISM_COMMON: HUMAN;                                              
SOURCE  18 ORGANISM_TAXID: 9606;                                                
SOURCE  19 GENE: JARID2, JMJ;                                                   
SOURCE  20 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  21 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  22 MOL_ID: 4;                                                           
SOURCE  23 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  24 ORGANISM_COMMON: HUMAN;                                              
SOURCE  25 ORGANISM_TAXID: 9606;                                                
SOURCE  26 GENE: EZH2, KMT6;                                                    
SOURCE  27 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  28 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  29 MOL_ID: 5;                                                           
SOURCE  30 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  31 ORGANISM_COMMON: HUMAN;                                              
SOURCE  32 ORGANISM_TAXID: 9606;                                                
SOURCE  33 GENE: EED;                                                           
SOURCE  34 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  35 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  36 MOL_ID: 6;                                                           
SOURCE  37 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  38 ORGANISM_COMMON: HUMAN;                                              
SOURCE  39 ORGANISM_TAXID: 9606;                                                
SOURCE  40 GENE: RBBP4, RBAP48;                                                 
SOURCE  41 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  42 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  43 MOL_ID: 7;                                                           
SOURCE  44 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  45 ORGANISM_TAXID: 9606;                                                
SOURCE  46 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  47 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  48 MOL_ID: 8;                                                           
SOURCE  49 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  50 ORGANISM_COMMON: HUMAN;                                              
SOURCE  51 ORGANISM_TAXID: 9606;                                                
SOURCE  52 GENE: AEBP2;                                                         
SOURCE  53 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  54 EXPRESSION_SYSTEM_TAXID: 7111;                                       
SOURCE  55 MOL_ID: 9;                                                           
SOURCE  56 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  57 ORGANISM_TAXID: 9606;                                                
SOURCE  58 EXPRESSION_SYSTEM: TRICHOPLUSIA NI;                                  
SOURCE  59 EXPRESSION_SYSTEM_TAXID: 7111                                        
KEYWDS    POLYCOMB REPRESSIVE COMPLEX, AEBP2, JARID2, HISTONE MODIFICATION,     
KEYWDS   2 GENE REGULATION                                                      
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    V.KASINATH,M.FAINI,S.POEPSEL,D.REIF,A.FENG,G.STJEPANOVIC,R.AEBERSOLD, 
AUTHOR   2 E.NOGALES                                                            
REVDAT   5   03-OCT-18 6C24    1       REMARK                                   
REVDAT   4   07-MAR-18 6C24    1       JRNL                                     
REVDAT   3   14-FEB-18 6C24    1       REMARK                                   
REVDAT   2   31-JAN-18 6C24    1       JRNL                                     
REVDAT   1   24-JAN-18 6C24    0                                                
JRNL        AUTH   V.KASINATH,M.FAINI,S.POEPSEL,D.REIF,X.A.FENG,G.STJEPANOVIC,  
JRNL        AUTH 2 R.AEBERSOLD,E.NOGALES                                        
JRNL        TITL   STRUCTURES OF HUMAN PRC2 WITH ITS COFACTORS AEBP2 AND        
JRNL        TITL 2 JARID2.                                                      
JRNL        REF    SCIENCE                       V. 359   940 2018              
JRNL        REFN                   ESSN 1095-9203                               
JRNL        PMID   29348366                                                     
JRNL        DOI    10.1126/SCIENCE.AAR5700                                      
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.50 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : NULL                                      
REMARK   3   RECONSTRUCTION SCHEMA  : NULL                                      
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : NULL                                
REMARK   3   REFINEMENT SPACE             : NULL                                
REMARK   3   REFINEMENT PROTOCOL          : NULL                                
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 3.500                          
REMARK   3   NUMBER OF PARTICLES               : 249696                         
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING ONLY            
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 6C24 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 08-JAN-18.                  
REMARK 100 THE DEPOSITION ID IS D_1000231960.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : TERNARY COMPLEX OF PRC2 WITH      
REMARK 245                                    COFACTORS AEBP2 AND JARID2        
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : NULL                              
REMARK 245   SAMPLE SUPPORT DETAILS         : NULL                              
REMARK 245   SAMPLE VITRIFICATION DETAILS   : NULL                              
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.90                              
REMARK 245   SAMPLE DETAILS                 : NULL                              
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : NULL                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : GATAN K2 SUMMIT (4K X 4K)      
REMARK 245   MINIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MAXIMUM DEFOCUS (NM)              : NULL                           
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : NULL                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 60.00                          
REMARK 245   ILLUMINATION MODE                 : SPOT SCAN                      
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : NULL                           
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: DODECAMERIC                       
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, E, K, L, M, N, O, P, Q,         
REMARK 350                    AND CHAINS: Z, C                                  
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     MET A     1                                                      
REMARK 465     ALA A     2                                                      
REMARK 465     PRO A     3                                                      
REMARK 465     GLN A     4                                                      
REMARK 465     LYS A     5                                                      
REMARK 465     HIS A     6                                                      
REMARK 465     GLY A     7                                                      
REMARK 465     GLY A     8                                                      
REMARK 465     GLY A     9                                                      
REMARK 465     GLY A    10                                                      
REMARK 465     GLY A    11                                                      
REMARK 465     GLY A    12                                                      
REMARK 465     GLY A    13                                                      
REMARK 465     SER A    14                                                      
REMARK 465     GLY A    15                                                      
REMARK 465     PRO A    16                                                      
REMARK 465     SER A    17                                                      
REMARK 465     ALA A    18                                                      
REMARK 465     GLY A    19                                                      
REMARK 465     SER A    20                                                      
REMARK 465     GLY A    21                                                      
REMARK 465     GLY A    22                                                      
REMARK 465     GLY A    23                                                      
REMARK 465     GLY A    24                                                      
REMARK 465     PHE A    25                                                      
REMARK 465     GLY A    26                                                      
REMARK 465     GLY A    27                                                      
REMARK 465     SER A    28                                                      
REMARK 465     ALA A    29                                                      
REMARK 465     ALA A    30                                                      
REMARK 465     VAL A    31                                                      
REMARK 465     ALA A    32                                                      
REMARK 465     ALA A    33                                                      
REMARK 465     ALA A    34                                                      
REMARK 465     THR A    35                                                      
REMARK 465     ALA A    36                                                      
REMARK 465     SER A    37                                                      
REMARK 465     GLY A    38                                                      
REMARK 465     GLY A    39                                                      
REMARK 465     LYS A    40                                                      
REMARK 465     SER A    41                                                      
REMARK 465     GLY A    42                                                      
REMARK 465     GLY A    43                                                      
REMARK 465     GLY A    44                                                      
REMARK 465     SER A    45                                                      
REMARK 465     CYS A    46                                                      
REMARK 465     GLY A    47                                                      
REMARK 465     GLY A    48                                                      
REMARK 465     GLY A    49                                                      
REMARK 465     GLY A    50                                                      
REMARK 465     SER A    51                                                      
REMARK 465     TYR A    52                                                      
REMARK 465     SER A    53                                                      
REMARK 465     ALA A    54                                                      
REMARK 465     SER A    55                                                      
REMARK 465     SER A    56                                                      
REMARK 465     SER A    57                                                      
REMARK 465     SER A    58                                                      
REMARK 465     SER A    59                                                      
REMARK 465     ALA A    60                                                      
REMARK 465     ALA A    61                                                      
REMARK 465     ALA A    62                                                      
REMARK 465     ALA A    63                                                      
REMARK 465     ALA A    64                                                      
REMARK 465     GLY A    65                                                      
REMARK 465     ALA A    66                                                      
REMARK 465     ALA A    67                                                      
REMARK 465     VAL A    68                                                      
REMARK 465     LEU A    69                                                      
REMARK 465     PRO A    70                                                      
REMARK 465     VAL A    71                                                      
REMARK 465     LYS A    72                                                      
REMARK 465     LYS A    73                                                      
REMARK 465     PRO A    74                                                      
REMARK 465     LYS A    75                                                      
REMARK 465     MET A    76                                                      
REMARK 465     GLU A    77                                                      
REMARK 465     HIS A    78                                                      
REMARK 465     VAL A    79                                                      
REMARK 465     GLN A    80                                                      
REMARK 465     ALA A    81                                                      
REMARK 465     ASP A    82                                                      
REMARK 465     HIS A    83                                                      
REMARK 465     GLU A    84                                                      
REMARK 465     LEU A    85                                                      
REMARK 465     PHE A    86                                                      
REMARK 465     LEU A    87                                                      
REMARK 465     GLN A    88                                                      
REMARK 465     ALA A    89                                                      
REMARK 465     PHE A    90                                                      
REMARK 465     GLU A    91                                                      
REMARK 465     LYS A    92                                                      
REMARK 465     PRO A    93                                                      
REMARK 465     THR A    94                                                      
REMARK 465     GLN A    95                                                      
REMARK 465     ILE A    96                                                      
REMARK 465     TYR A    97                                                      
REMARK 465     ARG A    98                                                      
REMARK 465     PHE A    99                                                      
REMARK 465     LEU A   100                                                      
REMARK 465     ARG A   101                                                      
REMARK 465     THR A   102                                                      
REMARK 465     ARG A   103                                                      
REMARK 465     ASN A   104                                                      
REMARK 465     LEU A   105                                                      
REMARK 465     ILE A   106                                                      
REMARK 465     ALA A   107                                                      
REMARK 465     PRO A   108                                                      
REMARK 465     ILE A   109                                                      
REMARK 465     PHE A   110                                                      
REMARK 465     LEU A   111                                                      
REMARK 465     HIS A   112                                                      
REMARK 465     ARG A   113                                                      
REMARK 465     THR A   114                                                      
REMARK 465     LEU A   115                                                      
REMARK 465     THR A   116                                                      
REMARK 465     TYR A   117                                                      
REMARK 465     MET A   118                                                      
REMARK 465     SER A   119                                                      
REMARK 465     HIS A   120                                                      
REMARK 465     ARG A   121                                                      
REMARK 465     ASN A   122                                                      
REMARK 465     SER A   123                                                      
REMARK 465     ARG A   124                                                      
REMARK 465     THR A   125                                                      
REMARK 465     ASN A   126                                                      
REMARK 465     ILE A   127                                                      
REMARK 465     LYS A   128                                                      
REMARK 465     ARG A   129                                                      
REMARK 465     LYS A   130                                                      
REMARK 465     THR A   131                                                      
REMARK 465     PHE A   132                                                      
REMARK 465     LYS A   133                                                      
REMARK 465     VAL A   134                                                      
REMARK 465     ASP A   135                                                      
REMARK 465     ASP A   136                                                      
REMARK 465     MET A   137                                                      
REMARK 465     LEU A   138                                                      
REMARK 465     SER A   139                                                      
REMARK 465     LYS A   140                                                      
REMARK 465     VAL A   141                                                      
REMARK 465     GLU A   142                                                      
REMARK 465     LYS A   143                                                      
REMARK 465     MET A   144                                                      
REMARK 465     LYS A   145                                                      
REMARK 465     GLY A   146                                                      
REMARK 465     GLU A   147                                                      
REMARK 465     GLN A   148                                                      
REMARK 465     GLU A   149                                                      
REMARK 465     SER A   150                                                      
REMARK 465     HIS A   151                                                      
REMARK 465     SER A   152                                                      
REMARK 465     LEU A   153                                                      
REMARK 465     SER A   154                                                      
REMARK 465     ALA A   155                                                      
REMARK 465     HIS A   156                                                      
REMARK 465     LEU A   157                                                      
REMARK 465     GLN A   158                                                      
REMARK 465     LEU A   159                                                      
REMARK 465     THR A   160                                                      
REMARK 465     PHE A   161                                                      
REMARK 465     THR A   162                                                      
REMARK 465     GLY A   163                                                      
REMARK 465     PHE A   164                                                      
REMARK 465     PHE A   165                                                      
REMARK 465     HIS A   166                                                      
REMARK 465     LYS A   167                                                      
REMARK 465     ASN A   168                                                      
REMARK 465     ASP A   169                                                      
REMARK 465     LYS A   170                                                      
REMARK 465     PRO A   171                                                      
REMARK 465     SER A   172                                                      
REMARK 465     PRO A   173                                                      
REMARK 465     ASN A   174                                                      
REMARK 465     SER A   175                                                      
REMARK 465     GLU A   176                                                      
REMARK 465     ASN A   177                                                      
REMARK 465     GLU A   178                                                      
REMARK 465     GLN A   179                                                      
REMARK 465     ASN A   180                                                      
REMARK 465     SER A   181                                                      
REMARK 465     VAL A   182                                                      
REMARK 465     THR A   183                                                      
REMARK 465     LEU A   184                                                      
REMARK 465     GLU A   185                                                      
REMARK 465     VAL A   186                                                      
REMARK 465     LEU A   187                                                      
REMARK 465     LEU A   188                                                      
REMARK 465     VAL A   189                                                      
REMARK 465     LYS A   190                                                      
REMARK 465     VAL A   191                                                      
REMARK 465     CYS A   192                                                      
REMARK 465     HIS A   193                                                      
REMARK 465     LYS A   194                                                      
REMARK 465     LYS A   195                                                      
REMARK 465     ARG A   196                                                      
REMARK 465     LYS A   197                                                      
REMARK 465     ASP A   198                                                      
REMARK 465     VAL A   199                                                      
REMARK 465     SER A   200                                                      
REMARK 465     CYS A   201                                                      
REMARK 465     PRO A   202                                                      
REMARK 465     ILE A   203                                                      
REMARK 465     ARG A   204                                                      
REMARK 465     GLN A   205                                                      
REMARK 465     VAL A   206                                                      
REMARK 465     PRO A   207                                                      
REMARK 465     THR A   208                                                      
REMARK 465     GLY A   209                                                      
REMARK 465     LYS A   210                                                      
REMARK 465     LYS A   211                                                      
REMARK 465     GLN A   212                                                      
REMARK 465     VAL A   213                                                      
REMARK 465     PRO A   214                                                      
REMARK 465     LEU A   215                                                      
REMARK 465     ASN A   216                                                      
REMARK 465     PRO A   217                                                      
REMARK 465     ASP A   218                                                      
REMARK 465     LEU A   219                                                      
REMARK 465     ASN A   220                                                      
REMARK 465     GLN A   221                                                      
REMARK 465     THR A   222                                                      
REMARK 465     LYS A   223                                                      
REMARK 465     PRO A   224                                                      
REMARK 465     GLY A   225                                                      
REMARK 465     ASN A   226                                                      
REMARK 465     PHE A   227                                                      
REMARK 465     PRO A   228                                                      
REMARK 465     SER A   229                                                      
REMARK 465     LEU A   230                                                      
REMARK 465     ALA A   231                                                      
REMARK 465     VAL A   232                                                      
REMARK 465     SER A   233                                                      
REMARK 465     SER A   234                                                      
REMARK 465     ASN A   235                                                      
REMARK 465     GLU A   236                                                      
REMARK 465     PHE A   237                                                      
REMARK 465     GLU A   238                                                      
REMARK 465     PRO A   239                                                      
REMARK 465     SER A   240                                                      
REMARK 465     ASN A   241                                                      
REMARK 465     SER A   242                                                      
REMARK 465     HIS A   243                                                      
REMARK 465     MET A   244                                                      
REMARK 465     VAL A   245                                                      
REMARK 465     LYS A   246                                                      
REMARK 465     SER A   247                                                      
REMARK 465     TYR A   248                                                      
REMARK 465     SER A   249                                                      
REMARK 465     LEU A   250                                                      
REMARK 465     LEU A   251                                                      
REMARK 465     PHE A   252                                                      
REMARK 465     ARG A   253                                                      
REMARK 465     VAL A   254                                                      
REMARK 465     THR A   255                                                      
REMARK 465     ARG A   256                                                      
REMARK 465     PRO A   257                                                      
REMARK 465     GLY A   258                                                      
REMARK 465     ARG A   259                                                      
REMARK 465     ARG A   260                                                      
REMARK 465     GLU A   261                                                      
REMARK 465     PHE A   262                                                      
REMARK 465     ASN A   263                                                      
REMARK 465     GLY A   264                                                      
REMARK 465     MET A   265                                                      
REMARK 465     ILE A   266                                                      
REMARK 465     ASN A   267                                                      
REMARK 465     GLY A   268                                                      
REMARK 465     GLU A   269                                                      
REMARK 465     THR A   270                                                      
REMARK 465     ASN A   271                                                      
REMARK 465     GLU A   272                                                      
REMARK 465     ASN A   273                                                      
REMARK 465     ILE A   274                                                      
REMARK 465     ASP A   275                                                      
REMARK 465     VAL A   276                                                      
REMARK 465     ASN A   277                                                      
REMARK 465     GLU A   278                                                      
REMARK 465     GLU A   279                                                      
REMARK 465     LEU A   280                                                      
REMARK 465     PRO A   281                                                      
REMARK 465     ALA A   282                                                      
REMARK 465     ARG A   283                                                      
REMARK 465     ARG A   284                                                      
REMARK 465     LYS A   285                                                      
REMARK 465     ARG A   286                                                      
REMARK 465     ASN A   287                                                      
REMARK 465     ARG A   288                                                      
REMARK 465     GLU A   289                                                      
REMARK 465     ASP A   290                                                      
REMARK 465     GLY A   291                                                      
REMARK 465     GLU A   292                                                      
REMARK 465     LYS A   293                                                      
REMARK 465     THR A   294                                                      
REMARK 465     PHE A   295                                                      
REMARK 465     VAL A   296                                                      
REMARK 465     ALA A   297                                                      
REMARK 465     GLN A   298                                                      
REMARK 465     MET A   299                                                      
REMARK 465     THR A   300                                                      
REMARK 465     VAL A   301                                                      
REMARK 465     PHE A   302                                                      
REMARK 465     ASP A   303                                                      
REMARK 465     LYS A   304                                                      
REMARK 465     ASN A   305                                                      
REMARK 465     ARG A   306                                                      
REMARK 465     ARG A   307                                                      
REMARK 465     LEU A   308                                                      
REMARK 465     GLN A   309                                                      
REMARK 465     LEU A   310                                                      
REMARK 465     LEU A   311                                                      
REMARK 465     ASP A   312                                                      
REMARK 465     GLY A   313                                                      
REMARK 465     GLU A   314                                                      
REMARK 465     TYR A   315                                                      
REMARK 465     GLU A   316                                                      
REMARK 465     VAL A   317                                                      
REMARK 465     ALA A   318                                                      
REMARK 465     MET A   319                                                      
REMARK 465     GLN A   320                                                      
REMARK 465     GLU A   321                                                      
REMARK 465     MET A   322                                                      
REMARK 465     GLU A   323                                                      
REMARK 465     GLU A   324                                                      
REMARK 465     CYS A   325                                                      
REMARK 465     PRO A   326                                                      
REMARK 465     ILE A   327                                                      
REMARK 465     SER A   328                                                      
REMARK 465     LYS A   329                                                      
REMARK 465     LYS A   330                                                      
REMARK 465     ARG A   331                                                      
REMARK 465     ALA A   332                                                      
REMARK 465     THR A   333                                                      
REMARK 465     TRP A   334                                                      
REMARK 465     GLU A   335                                                      
REMARK 465     THR A   336                                                      
REMARK 465     ILE A   337                                                      
REMARK 465     LEU A   338                                                      
REMARK 465     ASP A   339                                                      
REMARK 465     GLY A   340                                                      
REMARK 465     LYS A   341                                                      
REMARK 465     ARG A   342                                                      
REMARK 465     LEU A   343                                                      
REMARK 465     PRO A   344                                                      
REMARK 465     PRO A   345                                                      
REMARK 465     PHE A   346                                                      
REMARK 465     GLU A   347                                                      
REMARK 465     THR A   348                                                      
REMARK 465     PHE A   349                                                      
REMARK 465     SER A   350                                                      
REMARK 465     GLN A   351                                                      
REMARK 465     GLY A   352                                                      
REMARK 465     PRO A   353                                                      
REMARK 465     THR A   354                                                      
REMARK 465     LEU A   355                                                      
REMARK 465     GLN A   356                                                      
REMARK 465     PHE A   357                                                      
REMARK 465     THR A   358                                                      
REMARK 465     LEU A   359                                                      
REMARK 465     ARG A   360                                                      
REMARK 465     TRP A   361                                                      
REMARK 465     THR A   362                                                      
REMARK 465     GLY A   363                                                      
REMARK 465     GLU A   364                                                      
REMARK 465     THR A   365                                                      
REMARK 465     ASN A   366                                                      
REMARK 465     ASP A   367                                                      
REMARK 465     LYS A   368                                                      
REMARK 465     SER A   369                                                      
REMARK 465     THR A   370                                                      
REMARK 465     ALA A   371                                                      
REMARK 465     PRO A   372                                                      
REMARK 465     ILE A   373                                                      
REMARK 465     ALA A   374                                                      
REMARK 465     LYS A   375                                                      
REMARK 465     PRO A   376                                                      
REMARK 465     LEU A   377                                                      
REMARK 465     ALA A   378                                                      
REMARK 465     THR A   379                                                      
REMARK 465     ARG A   380                                                      
REMARK 465     ASN A   381                                                      
REMARK 465     SER A   382                                                      
REMARK 465     GLU A   383                                                      
REMARK 465     SER A   384                                                      
REMARK 465     LEU A   385                                                      
REMARK 465     HIS A   386                                                      
REMARK 465     GLN A   387                                                      
REMARK 465     GLU A   388                                                      
REMARK 465     ASN A   389                                                      
REMARK 465     LYS A   390                                                      
REMARK 465     PRO A   391                                                      
REMARK 465     GLY A   392                                                      
REMARK 465     SER A   393                                                      
REMARK 465     VAL A   394                                                      
REMARK 465     LYS A   395                                                      
REMARK 465     PRO A   396                                                      
REMARK 465     THR A   397                                                      
REMARK 465     GLN A   398                                                      
REMARK 465     THR A   399                                                      
REMARK 465     ILE A   400                                                      
REMARK 465     ALA A   401                                                      
REMARK 465     VAL A   402                                                      
REMARK 465     LYS A   403                                                      
REMARK 465     GLU A   404                                                      
REMARK 465     SER A   405                                                      
REMARK 465     LEU A   406                                                      
REMARK 465     THR A   407                                                      
REMARK 465     THR A   408                                                      
REMARK 465     ASP A   409                                                      
REMARK 465     LEU A   410                                                      
REMARK 465     GLN A   411                                                      
REMARK 465     THR A   412                                                      
REMARK 465     ARG A   413                                                      
REMARK 465     LYS A   414                                                      
REMARK 465     GLU A   415                                                      
REMARK 465     LYS A   416                                                      
REMARK 465     ASP A   417                                                      
REMARK 465     THR A   418                                                      
REMARK 465     PRO A   419                                                      
REMARK 465     ASN A   420                                                      
REMARK 465     GLU A   421                                                      
REMARK 465     ASN A   422                                                      
REMARK 465     ARG A   423                                                      
REMARK 465     GLN A   424                                                      
REMARK 465     LYS A   425                                                      
REMARK 465     GLY A   549                                                      
REMARK 465     GLU A   550                                                      
REMARK 465     VAL A   551                                                      
REMARK 465     GLU A   552                                                      
REMARK 465     GLN A   553                                                      
REMARK 465     GLN A   554                                                      
REMARK 465     ARG A   555                                                      
REMARK 465     THR A   556                                                      
REMARK 465     TYR A   557                                                      
REMARK 465     SER A   558                                                      
REMARK 465     SER A   559                                                      
REMARK 465     GLY A   560                                                      
REMARK 465     HIS A   561                                                      
REMARK 465     ASN A   562                                                      
REMARK 465     ARG A   563                                                      
REMARK 465     LEU A   564                                                      
REMARK 465     TYR A   565                                                      
REMARK 465     PHE A   566                                                      
REMARK 465     HIS A   567                                                      
REMARK 465     SER A   568                                                      
REMARK 465     ASP A   569                                                      
REMARK 465     THR A   570                                                      
REMARK 465     CYS A   571                                                      
REMARK 465     LEU A   572                                                      
REMARK 465     PRO A   573                                                      
REMARK 465     LEU A   574                                                      
REMARK 465     ARG A   575                                                      
REMARK 465     PRO A   576                                                      
REMARK 465     GLN A   577                                                      
REMARK 465     GLU A   578                                                      
REMARK 465     MET A   579                                                      
REMARK 465     GLU A   580                                                      
REMARK 465     VAL A   581                                                      
REMARK 465     ASP A   582                                                      
REMARK 465     SER A   583                                                      
REMARK 465     GLU A   584                                                      
REMARK 465     ASP A   585                                                      
REMARK 465     GLU A   586                                                      
REMARK 465     LYS A   587                                                      
REMARK 465     ASP A   588                                                      
REMARK 465     PRO A   589                                                      
REMARK 465     GLU A   590                                                      
REMARK 465     TRP A   591                                                      
REMARK 465     LEU A   592                                                      
REMARK 465     ARG A   593                                                      
REMARK 465     GLU A   594                                                      
REMARK 465     LYS A   595                                                      
REMARK 465     THR A   596                                                      
REMARK 465     ILE A   597                                                      
REMARK 465     THR A   598                                                      
REMARK 465     GLN A   599                                                      
REMARK 465     ILE A   600                                                      
REMARK 465     GLU A   601                                                      
REMARK 465     GLU A   602                                                      
REMARK 465     PHE A   603                                                      
REMARK 465     SER A   604                                                      
REMARK 465     ASP A   605                                                      
REMARK 465     VAL A   606                                                      
REMARK 465     ASN A   607                                                      
REMARK 465     GLU A   608                                                      
REMARK 465     GLY A   609                                                      
REMARK 465     GLU A   610                                                      
REMARK 465     LYS A   611                                                      
REMARK 465     GLU A   612                                                      
REMARK 465     VAL A   613                                                      
REMARK 465     MET A   614                                                      
REMARK 465     LYS A   615                                                      
REMARK 465     LEU A   616                                                      
REMARK 465     TRP A   617                                                      
REMARK 465     ASN A   618                                                      
REMARK 465     LEU A   619                                                      
REMARK 465     HIS A   620                                                      
REMARK 465     VAL A   621                                                      
REMARK 465     MET A   622                                                      
REMARK 465     LYS A   623                                                      
REMARK 465     HIS A   624                                                      
REMARK 465     GLY A   625                                                      
REMARK 465     PHE A   626                                                      
REMARK 465     ILE A   627                                                      
REMARK 465     ALA A   628                                                      
REMARK 465     ASP A   629                                                      
REMARK 465     ASN A   630                                                      
REMARK 465     GLN A   631                                                      
REMARK 465     MET A   632                                                      
REMARK 465     ASN A   633                                                      
REMARK 465     HIS A   634                                                      
REMARK 465     ALA A   635                                                      
REMARK 465     CYS A   636                                                      
REMARK 465     MET A   637                                                      
REMARK 465     LEU A   638                                                      
REMARK 465     PHE A   639                                                      
REMARK 465     VAL A   640                                                      
REMARK 465     GLU A   641                                                      
REMARK 465     ASN A   642                                                      
REMARK 465     TYR A   643                                                      
REMARK 465     GLY A   644                                                      
REMARK 465     GLN A   645                                                      
REMARK 465     LYS A   646                                                      
REMARK 465     ILE A   647                                                      
REMARK 465     ILE A   648                                                      
REMARK 465     LYS A   649                                                      
REMARK 465     LYS A   650                                                      
REMARK 465     ASN A   651                                                      
REMARK 465     LEU A   652                                                      
REMARK 465     CYS A   653                                                      
REMARK 465     ARG A   654                                                      
REMARK 465     ASN A   655                                                      
REMARK 465     PHE A   656                                                      
REMARK 465     MET A   657                                                      
REMARK 465     LEU A   658                                                      
REMARK 465     HIS A   659                                                      
REMARK 465     LEU A   660                                                      
REMARK 465     VAL A   661                                                      
REMARK 465     SER A   662                                                      
REMARK 465     MET A   663                                                      
REMARK 465     HIS A   664                                                      
REMARK 465     ASP A   665                                                      
REMARK 465     PHE A   666                                                      
REMARK 465     ASN A   667                                                      
REMARK 465     LEU A   668                                                      
REMARK 465     ILE A   669                                                      
REMARK 465     SER A   670                                                      
REMARK 465     ILE A   671                                                      
REMARK 465     MET A   672                                                      
REMARK 465     SER A   673                                                      
REMARK 465     ILE A   674                                                      
REMARK 465     ASP A   675                                                      
REMARK 465     LYS A   676                                                      
REMARK 465     ALA A   677                                                      
REMARK 465     VAL A   678                                                      
REMARK 465     THR A   679                                                      
REMARK 465     LYS A   680                                                      
REMARK 465     LEU A   681                                                      
REMARK 465     ARG A   682                                                      
REMARK 465     GLU A   683                                                      
REMARK 465     MET A   684                                                      
REMARK 465     GLN A   685                                                      
REMARK 465     GLN A   686                                                      
REMARK 465     LYS A   687                                                      
REMARK 465     LEU A   688                                                      
REMARK 465     GLU A   689                                                      
REMARK 465     LYS A   690                                                      
REMARK 465     GLY A   691                                                      
REMARK 465     GLU A   692                                                      
REMARK 465     SER A   693                                                      
REMARK 465     ALA A   694                                                      
REMARK 465     SER A   695                                                      
REMARK 465     PRO A   696                                                      
REMARK 465     ALA A   697                                                      
REMARK 465     ASN A   698                                                      
REMARK 465     GLU A   699                                                      
REMARK 465     GLU A   700                                                      
REMARK 465     ILE A   701                                                      
REMARK 465     THR A   702                                                      
REMARK 465     GLU A   703                                                      
REMARK 465     GLU A   704                                                      
REMARK 465     GLN A   705                                                      
REMARK 465     ASN A   706                                                      
REMARK 465     GLY A   707                                                      
REMARK 465     THR A   708                                                      
REMARK 465     ALA A   709                                                      
REMARK 465     ASN A   710                                                      
REMARK 465     GLY A   711                                                      
REMARK 465     PHE A   712                                                      
REMARK 465     SER A   713                                                      
REMARK 465     GLU A   714                                                      
REMARK 465     ILE A   715                                                      
REMARK 465     ASN A   716                                                      
REMARK 465     SER A   717                                                      
REMARK 465     LYS A   718                                                      
REMARK 465     GLU A   719                                                      
REMARK 465     LYS A   720                                                      
REMARK 465     ALA A   721                                                      
REMARK 465     LEU A   722                                                      
REMARK 465     GLU A   723                                                      
REMARK 465     THR A   724                                                      
REMARK 465     ASP A   725                                                      
REMARK 465     SER A   726                                                      
REMARK 465     VAL A   727                                                      
REMARK 465     SER A   728                                                      
REMARK 465     GLY A   729                                                      
REMARK 465     VAL A   730                                                      
REMARK 465     SER A   731                                                      
REMARK 465     LYS A   732                                                      
REMARK 465     GLN A   733                                                      
REMARK 465     SER A   734                                                      
REMARK 465     LYS A   735                                                      
REMARK 465     LYS A   736                                                      
REMARK 465     GLN A   737                                                      
REMARK 465     LYS A   738                                                      
REMARK 465     LEU A   739                                                      
REMARK 465     ARG B   106                                                      
REMARK 465     LYS B   107                                                      
REMARK 465     ARG B   108                                                      
REMARK 465     PRO B   109                                                      
REMARK 465     ARG B   110                                                      
REMARK 465     LEU B   111                                                      
REMARK 465     GLN B   112                                                      
REMARK 465     SER B   120                                                      
REMARK 465     GLN B   121                                                      
REMARK 465     PRO B   122                                                      
REMARK 465     ASN B   123                                                      
REMARK 465     SER B   124                                                      
REMARK 465     PRO B   125                                                      
REMARK 465     SER B   126                                                      
REMARK 465     THR B   127                                                      
REMARK 465     THR B   128                                                      
REMARK 465     PRO B   129                                                      
REMARK 465     VAL B   130                                                      
REMARK 465     LYS B   131                                                      
REMARK 465     ILE B   132                                                      
REMARK 465     VAL B   133                                                      
REMARK 465     GLU B   134                                                      
REMARK 465     PRO B   135                                                      
REMARK 465     LEU B   136                                                      
REMARK 465     LEU B   137                                                      
REMARK 465     PRO B   138                                                      
REMARK 465     PRO B   139                                                      
REMARK 465     PRO B   140                                                      
REMARK 465     ALA B   141                                                      
REMARK 465     THR B   142                                                      
REMARK 465     GLN B   143                                                      
REMARK 465     ILE B   144                                                      
REMARK 465     SER B   145                                                      
REMARK 465     ASP B   146                                                      
REMARK 465     LEU B   147                                                      
REMARK 465     SER B   148                                                      
REMARK 465     LYS B   149                                                      
REMARK 465     ARG B   150                                                      
REMARK 465     LYS B   151                                                      
REMARK 465     PRO B   152                                                      
REMARK 465     LYS B   153                                                      
REMARK 465     THR B   154                                                      
REMARK 465     GLU B   155                                                      
REMARK 465     ASP B   156                                                      
REMARK 465     PHE B   157                                                      
REMARK 465     LEU B   158                                                      
REMARK 465     THR B   159                                                      
REMARK 465     PHE B   160                                                      
REMARK 465     LEU B   161                                                      
REMARK 465     CYS B   162                                                      
REMARK 465     LEU B   163                                                      
REMARK 465     ARG B   164                                                      
REMARK 465     GLY B   165                                                      
REMARK 465     SER B   166                                                      
REMARK 465     PRO B   167                                                      
REMARK 465     ALA B   168                                                      
REMARK 465     LEU B   169                                                      
REMARK 465     PRO B   170                                                      
REMARK 465     ASN B   171                                                      
REMARK 465     SER B   172                                                      
REMARK 465     MET B   173                                                      
REMARK 465     VAL B   174                                                      
REMARK 465     TYR B   175                                                      
REMARK 465     PHE B   176                                                      
REMARK 465     GLY B   177                                                      
REMARK 465     SER B   178                                                      
REMARK 465     SER B   179                                                      
REMARK 465     GLN B   180                                                      
REMARK 465     ASP B   181                                                      
REMARK 465     GLU B   182                                                      
REMARK 465     GLU B   183                                                      
REMARK 465     GLU B   184                                                      
REMARK 465     VAL B   185                                                      
REMARK 465     GLU B   186                                                      
REMARK 465     GLU B   187                                                      
REMARK 465     GLU B   188                                                      
REMARK 465     ASP B   189                                                      
REMARK 465     ASP B   190                                                      
REMARK 465     GLU B   191                                                      
REMARK 465     THR B   192                                                      
REMARK 465     GLU B   193                                                      
REMARK 465     ASP B   194                                                      
REMARK 465     VAL B   195                                                      
REMARK 465     LYS B   196                                                      
REMARK 465     THR B   197                                                      
REMARK 465     ALA B   198                                                      
REMARK 465     THR B   199                                                      
REMARK 465     ASN B   200                                                      
REMARK 465     ASN B   201                                                      
REMARK 465     ALA B   202                                                      
REMARK 465     SER B   203                                                      
REMARK 465     SER B   204                                                      
REMARK 465     SER B   205                                                      
REMARK 465     CYS B   206                                                      
REMARK 465     GLN B   207                                                      
REMARK 465     SER B   208                                                      
REMARK 465     THR B   209                                                      
REMARK 465     PRO B   210                                                      
REMARK 465     ARG B   211                                                      
REMARK 465     LYS B   212                                                      
REMARK 465     GLY B   213                                                      
REMARK 465     LYS B   214                                                      
REMARK 465     THR B   215                                                      
REMARK 465     HIS B   216                                                      
REMARK 465     LYS B   217                                                      
REMARK 465     HIS B   218                                                      
REMARK 465     VAL B   219                                                      
REMARK 465     HIS B   220                                                      
REMARK 465     ASN B   221                                                      
REMARK 465     GLY B   222                                                      
REMARK 465     HIS B   223                                                      
REMARK 465     VAL B   224                                                      
REMARK 465     PHE B   225                                                      
REMARK 465     ASN B   226                                                      
REMARK 465     GLY B   227                                                      
REMARK 465     SER B   228                                                      
REMARK 465     SER B   229                                                      
REMARK 465     ARG B   230                                                      
REMARK 465     SER B   231                                                      
REMARK 465     THR B   232                                                      
REMARK 465     ARG B   233                                                      
REMARK 465     GLU B   234                                                      
REMARK 465     LYS B   235                                                      
REMARK 465     GLU B   236                                                      
REMARK 465     PRO B   237                                                      
REMARK 465     VAL B   238                                                      
REMARK 465     GLN B   239                                                      
REMARK 465     LYS B   240                                                      
REMARK 465     HIS B   241                                                      
REMARK 465     LYS B   242                                                      
REMARK 465     SER B   243                                                      
REMARK 465     LYS B   244                                                      
REMARK 465     GLU B   245                                                      
REMARK 465     ALA B   246                                                      
REMARK 465     THR B   247                                                      
REMARK 465     PRO B   248                                                      
REMARK 465     ALA B   249                                                      
REMARK 465     LYS B   250                                                      
REMARK 465     GLU B   251                                                      
REMARK 465     LYS B   252                                                      
REMARK 465     HIS B   253                                                      
REMARK 465     SER B   254                                                      
REMARK 465     ASP B   255                                                      
REMARK 465     HIS B   256                                                      
REMARK 465     ARG B   257                                                      
REMARK 465     ALA B   258                                                      
REMARK 465     ASP B   259                                                      
REMARK 465     SER B   260                                                      
REMARK 465     ARG B   261                                                      
REMARK 465     ARG B   262                                                      
REMARK 465     GLU B   263                                                      
REMARK 465     GLN B   264                                                      
REMARK 465     ALA B   265                                                      
REMARK 465     SER B   266                                                      
REMARK 465     ALA B   267                                                      
REMARK 465     ASN B   268                                                      
REMARK 465     HIS B   269                                                      
REMARK 465     PRO B   270                                                      
REMARK 465     ALA B   271                                                      
REMARK 465     ALA B   272                                                      
REMARK 465     ALA B   273                                                      
REMARK 465     PRO B   274                                                      
REMARK 465     SER B   275                                                      
REMARK 465     THR B   276                                                      
REMARK 465     GLY B   277                                                      
REMARK 465     SER B   278                                                      
REMARK 465     SER B   279                                                      
REMARK 465     ALA B   280                                                      
REMARK 465     LYS B   281                                                      
REMARK 465     GLY B   282                                                      
REMARK 465     LEU B   283                                                      
REMARK 465     ALA B   284                                                      
REMARK 465     ALA B   285                                                      
REMARK 465     THR B   286                                                      
REMARK 465     HIS B   287                                                      
REMARK 465     HIS B   288                                                      
REMARK 465     HIS B   289                                                      
REMARK 465     PRO B   290                                                      
REMARK 465     PRO B   291                                                      
REMARK 465     LEU B   292                                                      
REMARK 465     HIS B   293                                                      
REMARK 465     ARG B   294                                                      
REMARK 465     SER B   295                                                      
REMARK 465     ALA B   296                                                      
REMARK 465     GLN B   297                                                      
REMARK 465     ASP B   298                                                      
REMARK 465     LEU B   299                                                      
REMARK 465     ARG B   300                                                      
REMARK 465     LYS B   301                                                      
REMARK 465     GLN B   302                                                      
REMARK 465     VAL B   303                                                      
REMARK 465     SER B   304                                                      
REMARK 465     LYS B   305                                                      
REMARK 465     VAL B   306                                                      
REMARK 465     ASN B   307                                                      
REMARK 465     GLY B   308                                                      
REMARK 465     VAL B   309                                                      
REMARK 465     THR B   310                                                      
REMARK 465     ARG B   311                                                      
REMARK 465     MET B   312                                                      
REMARK 465     SER B   313                                                      
REMARK 465     SER B   314                                                      
REMARK 465     LEU B   315                                                      
REMARK 465     GLY B   316                                                      
REMARK 465     ALA B   317                                                      
REMARK 465     GLY B   318                                                      
REMARK 465     VAL B   319                                                      
REMARK 465     THR B   320                                                      
REMARK 465     SER B   321                                                      
REMARK 465     ALA B   322                                                      
REMARK 465     LYS B   323                                                      
REMARK 465     LYS B   324                                                      
REMARK 465     MET B   325                                                      
REMARK 465     ARG B   326                                                      
REMARK 465     GLU B   327                                                      
REMARK 465     VAL B   328                                                      
REMARK 465     ARG B   329                                                      
REMARK 465     PRO B   330                                                      
REMARK 465     SER B   331                                                      
REMARK 465     PRO B   332                                                      
REMARK 465     SER B   333                                                      
REMARK 465     LYS B   334                                                      
REMARK 465     THR B   335                                                      
REMARK 465     VAL B   336                                                      
REMARK 465     LYS B   337                                                      
REMARK 465     TYR B   338                                                      
REMARK 465     THR B   339                                                      
REMARK 465     ALA B   340                                                      
REMARK 465     THR B   341                                                      
REMARK 465     VAL B   342                                                      
REMARK 465     THR B   343                                                      
REMARK 465     LYS B   344                                                      
REMARK 465     GLY B   345                                                      
REMARK 465     ALA B   346                                                      
REMARK 465     VAL B   347                                                      
REMARK 465     THR B   348                                                      
REMARK 465     TYR B   349                                                      
REMARK 465     THR B   350                                                      
REMARK 465     LYS B   351                                                      
REMARK 465     ALA B   352                                                      
REMARK 465     LYS B   353                                                      
REMARK 465     ARG B   354                                                      
REMARK 465     GLU B   355                                                      
REMARK 465     LEU B   356                                                      
REMARK 465     VAL B   357                                                      
REMARK 465     LYS B   358                                                      
REMARK 465     ASP B   359                                                      
REMARK 465     THR B   360                                                      
REMARK 465     LYS B   361                                                      
REMARK 465     PRO B   362                                                      
REMARK 465     ASN B   363                                                      
REMARK 465     HIS B   364                                                      
REMARK 465     HIS B   365                                                      
REMARK 465     LYS B   366                                                      
REMARK 465     PRO B   367                                                      
REMARK 465     SER B   368                                                      
REMARK 465     SER B   369                                                      
REMARK 465     ALA B   370                                                      
REMARK 465     VAL B   371                                                      
REMARK 465     ASN B   372                                                      
REMARK 465     HIS B   373                                                      
REMARK 465     THR B   374                                                      
REMARK 465     ILE B   375                                                      
REMARK 465     SER B   376                                                      
REMARK 465     GLY B   377                                                      
REMARK 465     LYS B   378                                                      
REMARK 465     THR B   379                                                      
REMARK 465     GLU B   380                                                      
REMARK 465     SER B   381                                                      
REMARK 465     SER B   382                                                      
REMARK 465     ASN B   383                                                      
REMARK 465     ALA B   384                                                      
REMARK 465     LYS B   385                                                      
REMARK 465     THR B   386                                                      
REMARK 465     ARG B   387                                                      
REMARK 465     LYS B   388                                                      
REMARK 465     GLN B   389                                                      
REMARK 465     VAL B   390                                                      
REMARK 465     LEU B   391                                                      
REMARK 465     SER B   392                                                      
REMARK 465     LEU B   393                                                      
REMARK 465     GLY B   394                                                      
REMARK 465     GLY B   395                                                      
REMARK 465     ALA B   396                                                      
REMARK 465     SER B   397                                                      
REMARK 465     LYS B   398                                                      
REMARK 465     SER B   399                                                      
REMARK 465     THR B   400                                                      
REMARK 465     GLY B   401                                                      
REMARK 465     PRO B   402                                                      
REMARK 465     ALA B   403                                                      
REMARK 465     VAL B   404                                                      
REMARK 465     ASN B   405                                                      
REMARK 465     GLY B   406                                                      
REMARK 465     LEU B   407                                                      
REMARK 465     LYS B   408                                                      
REMARK 465     VAL B   409                                                      
REMARK 465     SER B   410                                                      
REMARK 465     GLY B   411                                                      
REMARK 465     ARG B   412                                                      
REMARK 465     LEU B   413                                                      
REMARK 465     ASN B   414                                                      
REMARK 465     PRO B   415                                                      
REMARK 465     LYS B   416                                                      
REMARK 465     SER B   417                                                      
REMARK 465     CYS B   418                                                      
REMARK 465     THR B   419                                                      
REMARK 465     LYS B   420                                                      
REMARK 465     GLU B   421                                                      
REMARK 465     VAL B   422                                                      
REMARK 465     GLY B   423                                                      
REMARK 465     GLY B   424                                                      
REMARK 465     ARG B   425                                                      
REMARK 465     GLN B   426                                                      
REMARK 465     LEU B   427                                                      
REMARK 465     ARG B   428                                                      
REMARK 465     GLU B   429                                                      
REMARK 465     GLY B   430                                                      
REMARK 465     LEU B   431                                                      
REMARK 465     GLN B   432                                                      
REMARK 465     LEU B   433                                                      
REMARK 465     ARG B   434                                                      
REMARK 465     GLU B   435                                                      
REMARK 465     GLY B   436                                                      
REMARK 465     LEU B   437                                                      
REMARK 465     ARG B   438                                                      
REMARK 465     ASN B   439                                                      
REMARK 465     SER B   440                                                      
REMARK 465     LYS B   441                                                      
REMARK 465     ARG B   442                                                      
REMARK 465     ARG B   443                                                      
REMARK 465     LEU B   444                                                      
REMARK 465     GLU B   445                                                      
REMARK 465     GLU B   446                                                      
REMARK 465     ALA B   447                                                      
REMARK 465     HIS B   448                                                      
REMARK 465     GLN B   449                                                      
REMARK 465     ALA B   450                                                      
REMARK 465     ARG E   106                                                      
REMARK 465     LYS E   107                                                      
REMARK 465     ARG E   108                                                      
REMARK 465     PRO E   109                                                      
REMARK 465     ARG E   110                                                      
REMARK 465     LEU E   111                                                      
REMARK 465     GLN E   112                                                      
REMARK 465     ALA E   113                                                      
REMARK 465     GLN E   114                                                      
REMARK 465     ARG E   115                                                      
REMARK 465     LYS E   116                                                      
REMARK 465     PHE E   117                                                      
REMARK 465     ALA E   118                                                      
REMARK 465     GLN E   119                                                      
REMARK 465     SER E   120                                                      
REMARK 465     GLN E   121                                                      
REMARK 465     PRO E   122                                                      
REMARK 465     ASN E   123                                                      
REMARK 465     SER E   124                                                      
REMARK 465     PRO E   125                                                      
REMARK 465     SER E   126                                                      
REMARK 465     THR E   127                                                      
REMARK 465     THR E   128                                                      
REMARK 465     PRO E   129                                                      
REMARK 465     VAL E   130                                                      
REMARK 465     LYS E   131                                                      
REMARK 465     ILE E   132                                                      
REMARK 465     VAL E   133                                                      
REMARK 465     GLU E   134                                                      
REMARK 465     PRO E   135                                                      
REMARK 465     LEU E   136                                                      
REMARK 465     LEU E   137                                                      
REMARK 465     PRO E   138                                                      
REMARK 465     PRO E   139                                                      
REMARK 465     PRO E   167                                                      
REMARK 465     ALA E   168                                                      
REMARK 465     LEU E   169                                                      
REMARK 465     PRO E   170                                                      
REMARK 465     ASN E   171                                                      
REMARK 465     SER E   172                                                      
REMARK 465     MET E   173                                                      
REMARK 465     VAL E   174                                                      
REMARK 465     TYR E   175                                                      
REMARK 465     PHE E   176                                                      
REMARK 465     GLY E   177                                                      
REMARK 465     SER E   178                                                      
REMARK 465     SER E   179                                                      
REMARK 465     GLN E   180                                                      
REMARK 465     ASP E   181                                                      
REMARK 465     GLU E   182                                                      
REMARK 465     GLU E   183                                                      
REMARK 465     GLU E   184                                                      
REMARK 465     VAL E   185                                                      
REMARK 465     GLU E   186                                                      
REMARK 465     GLU E   187                                                      
REMARK 465     GLU E   188                                                      
REMARK 465     ASP E   189                                                      
REMARK 465     ASP E   190                                                      
REMARK 465     GLU E   191                                                      
REMARK 465     THR E   192                                                      
REMARK 465     GLU E   193                                                      
REMARK 465     ASP E   194                                                      
REMARK 465     VAL E   195                                                      
REMARK 465     LYS E   196                                                      
REMARK 465     THR E   197                                                      
REMARK 465     ALA E   198                                                      
REMARK 465     THR E   199                                                      
REMARK 465     ASN E   200                                                      
REMARK 465     ASN E   201                                                      
REMARK 465     ALA E   202                                                      
REMARK 465     SER E   203                                                      
REMARK 465     SER E   204                                                      
REMARK 465     SER E   205                                                      
REMARK 465     CYS E   206                                                      
REMARK 465     GLN E   207                                                      
REMARK 465     SER E   208                                                      
REMARK 465     THR E   209                                                      
REMARK 465     PRO E   210                                                      
REMARK 465     ARG E   211                                                      
REMARK 465     LYS E   212                                                      
REMARK 465     GLY E   213                                                      
REMARK 465     LYS E   214                                                      
REMARK 465     THR E   215                                                      
REMARK 465     HIS E   216                                                      
REMARK 465     LYS E   217                                                      
REMARK 465     HIS E   218                                                      
REMARK 465     VAL E   219                                                      
REMARK 465     HIS E   220                                                      
REMARK 465     ASN E   221                                                      
REMARK 465     GLY E   222                                                      
REMARK 465     HIS E   223                                                      
REMARK 465     VAL E   224                                                      
REMARK 465     PHE E   225                                                      
REMARK 465     ASN E   226                                                      
REMARK 465     GLY E   227                                                      
REMARK 465     SER E   228                                                      
REMARK 465     SER E   229                                                      
REMARK 465     ARG E   230                                                      
REMARK 465     SER E   231                                                      
REMARK 465     THR E   232                                                      
REMARK 465     ARG E   233                                                      
REMARK 465     GLU E   234                                                      
REMARK 465     LYS E   235                                                      
REMARK 465     GLU E   236                                                      
REMARK 465     PRO E   237                                                      
REMARK 465     VAL E   238                                                      
REMARK 465     GLN E   239                                                      
REMARK 465     LYS E   240                                                      
REMARK 465     HIS E   241                                                      
REMARK 465     LYS E   242                                                      
REMARK 465     SER E   243                                                      
REMARK 465     LYS E   244                                                      
REMARK 465     GLU E   245                                                      
REMARK 465     ALA E   246                                                      
REMARK 465     THR E   247                                                      
REMARK 465     PRO E   248                                                      
REMARK 465     ALA E   249                                                      
REMARK 465     LYS E   250                                                      
REMARK 465     GLU E   251                                                      
REMARK 465     LYS E   252                                                      
REMARK 465     HIS E   253                                                      
REMARK 465     SER E   254                                                      
REMARK 465     ASP E   255                                                      
REMARK 465     HIS E   256                                                      
REMARK 465     ARG E   257                                                      
REMARK 465     ALA E   258                                                      
REMARK 465     ASP E   259                                                      
REMARK 465     SER E   260                                                      
REMARK 465     ARG E   261                                                      
REMARK 465     ARG E   262                                                      
REMARK 465     GLU E   263                                                      
REMARK 465     GLN E   264                                                      
REMARK 465     ALA E   265                                                      
REMARK 465     SER E   266                                                      
REMARK 465     ALA E   267                                                      
REMARK 465     ASN E   268                                                      
REMARK 465     HIS E   269                                                      
REMARK 465     PRO E   270                                                      
REMARK 465     ALA E   271                                                      
REMARK 465     ALA E   272                                                      
REMARK 465     ALA E   273                                                      
REMARK 465     PRO E   274                                                      
REMARK 465     SER E   275                                                      
REMARK 465     THR E   276                                                      
REMARK 465     GLY E   277                                                      
REMARK 465     SER E   278                                                      
REMARK 465     SER E   279                                                      
REMARK 465     ALA E   280                                                      
REMARK 465     LYS E   281                                                      
REMARK 465     GLY E   282                                                      
REMARK 465     LEU E   283                                                      
REMARK 465     ALA E   284                                                      
REMARK 465     ALA E   285                                                      
REMARK 465     THR E   286                                                      
REMARK 465     HIS E   287                                                      
REMARK 465     HIS E   288                                                      
REMARK 465     HIS E   289                                                      
REMARK 465     PRO E   290                                                      
REMARK 465     PRO E   291                                                      
REMARK 465     LEU E   292                                                      
REMARK 465     HIS E   293                                                      
REMARK 465     ARG E   294                                                      
REMARK 465     SER E   295                                                      
REMARK 465     ALA E   296                                                      
REMARK 465     GLN E   297                                                      
REMARK 465     ASP E   298                                                      
REMARK 465     LEU E   299                                                      
REMARK 465     ARG E   300                                                      
REMARK 465     LYS E   301                                                      
REMARK 465     GLN E   302                                                      
REMARK 465     VAL E   303                                                      
REMARK 465     SER E   304                                                      
REMARK 465     LYS E   305                                                      
REMARK 465     VAL E   306                                                      
REMARK 465     ASN E   307                                                      
REMARK 465     GLY E   308                                                      
REMARK 465     VAL E   309                                                      
REMARK 465     THR E   310                                                      
REMARK 465     ARG E   311                                                      
REMARK 465     MET E   312                                                      
REMARK 465     SER E   313                                                      
REMARK 465     SER E   314                                                      
REMARK 465     LEU E   315                                                      
REMARK 465     GLY E   316                                                      
REMARK 465     ALA E   317                                                      
REMARK 465     GLY E   318                                                      
REMARK 465     VAL E   319                                                      
REMARK 465     THR E   320                                                      
REMARK 465     SER E   321                                                      
REMARK 465     ALA E   322                                                      
REMARK 465     LYS E   323                                                      
REMARK 465     LYS E   324                                                      
REMARK 465     MET E   325                                                      
REMARK 465     ARG E   326                                                      
REMARK 465     GLU E   327                                                      
REMARK 465     VAL E   328                                                      
REMARK 465     ARG E   329                                                      
REMARK 465     PRO E   330                                                      
REMARK 465     SER E   331                                                      
REMARK 465     PRO E   332                                                      
REMARK 465     SER E   333                                                      
REMARK 465     LYS E   334                                                      
REMARK 465     THR E   335                                                      
REMARK 465     VAL E   336                                                      
REMARK 465     LYS E   337                                                      
REMARK 465     TYR E   338                                                      
REMARK 465     THR E   339                                                      
REMARK 465     ALA E   340                                                      
REMARK 465     THR E   341                                                      
REMARK 465     VAL E   342                                                      
REMARK 465     THR E   343                                                      
REMARK 465     LYS E   344                                                      
REMARK 465     GLY E   345                                                      
REMARK 465     ALA E   346                                                      
REMARK 465     VAL E   347                                                      
REMARK 465     THR E   348                                                      
REMARK 465     TYR E   349                                                      
REMARK 465     THR E   350                                                      
REMARK 465     LYS E   351                                                      
REMARK 465     ALA E   352                                                      
REMARK 465     LYS E   353                                                      
REMARK 465     ARG E   354                                                      
REMARK 465     GLU E   355                                                      
REMARK 465     LEU E   356                                                      
REMARK 465     VAL E   357                                                      
REMARK 465     LYS E   358                                                      
REMARK 465     ASP E   359                                                      
REMARK 465     THR E   360                                                      
REMARK 465     LYS E   361                                                      
REMARK 465     PRO E   362                                                      
REMARK 465     ASN E   363                                                      
REMARK 465     HIS E   364                                                      
REMARK 465     HIS E   365                                                      
REMARK 465     LYS E   366                                                      
REMARK 465     PRO E   367                                                      
REMARK 465     SER E   368                                                      
REMARK 465     SER E   369                                                      
REMARK 465     ALA E   370                                                      
REMARK 465     VAL E   371                                                      
REMARK 465     ASN E   372                                                      
REMARK 465     HIS E   373                                                      
REMARK 465     THR E   374                                                      
REMARK 465     ILE E   375                                                      
REMARK 465     SER E   376                                                      
REMARK 465     GLY E   377                                                      
REMARK 465     LYS E   378                                                      
REMARK 465     THR E   379                                                      
REMARK 465     GLU E   380                                                      
REMARK 465     SER E   381                                                      
REMARK 465     SER E   382                                                      
REMARK 465     ASN E   383                                                      
REMARK 465     ALA E   384                                                      
REMARK 465     LYS E   385                                                      
REMARK 465     THR E   386                                                      
REMARK 465     ARG E   387                                                      
REMARK 465     LYS E   388                                                      
REMARK 465     GLN E   389                                                      
REMARK 465     VAL E   390                                                      
REMARK 465     LEU E   391                                                      
REMARK 465     SER E   392                                                      
REMARK 465     LEU E   393                                                      
REMARK 465     GLY E   394                                                      
REMARK 465     GLY E   395                                                      
REMARK 465     ALA E   396                                                      
REMARK 465     SER E   397                                                      
REMARK 465     LYS E   398                                                      
REMARK 465     SER E   399                                                      
REMARK 465     THR E   400                                                      
REMARK 465     GLY E   401                                                      
REMARK 465     PRO E   402                                                      
REMARK 465     ALA E   403                                                      
REMARK 465     VAL E   404                                                      
REMARK 465     ASN E   405                                                      
REMARK 465     GLY E   406                                                      
REMARK 465     LEU E   407                                                      
REMARK 465     LYS E   408                                                      
REMARK 465     VAL E   409                                                      
REMARK 465     SER E   410                                                      
REMARK 465     GLY E   411                                                      
REMARK 465     ARG E   412                                                      
REMARK 465     LEU E   413                                                      
REMARK 465     ASN E   414                                                      
REMARK 465     PRO E   415                                                      
REMARK 465     LYS E   416                                                      
REMARK 465     SER E   417                                                      
REMARK 465     CYS E   418                                                      
REMARK 465     THR E   419                                                      
REMARK 465     LYS E   420                                                      
REMARK 465     GLU E   421                                                      
REMARK 465     VAL E   422                                                      
REMARK 465     GLY E   423                                                      
REMARK 465     GLY E   424                                                      
REMARK 465     ARG E   425                                                      
REMARK 465     GLN E   426                                                      
REMARK 465     LEU E   427                                                      
REMARK 465     ARG E   428                                                      
REMARK 465     GLU E   429                                                      
REMARK 465     GLY E   430                                                      
REMARK 465     LEU E   431                                                      
REMARK 465     GLN E   432                                                      
REMARK 465     LEU E   433                                                      
REMARK 465     ARG E   434                                                      
REMARK 465     GLU E   435                                                      
REMARK 465     GLY E   436                                                      
REMARK 465     LEU E   437                                                      
REMARK 465     ARG E   438                                                      
REMARK 465     ASN E   439                                                      
REMARK 465     SER E   440                                                      
REMARK 465     LYS E   441                                                      
REMARK 465     ARG E   442                                                      
REMARK 465     ARG E   443                                                      
REMARK 465     LEU E   444                                                      
REMARK 465     GLU E   445                                                      
REMARK 465     GLU E   446                                                      
REMARK 465     ALA E   447                                                      
REMARK 465     HIS E   448                                                      
REMARK 465     GLN E   449                                                      
REMARK 465     ALA E   450                                                      
REMARK 465     MET K     1                                                      
REMARK 465     GLY K     2                                                      
REMARK 465     GLN K     3                                                      
REMARK 465     THR K     4                                                      
REMARK 465     GLY K     5                                                      
REMARK 465     LYS K     6                                                      
REMARK 465     LYS K     7                                                      
REMARK 465     SER K     8                                                      
REMARK 465     GLU K     9                                                      
REMARK 465     LYS K    10                                                      
REMARK 465     GLY K    11                                                      
REMARK 465     PRO K    12                                                      
REMARK 465     VAL K    13                                                      
REMARK 465     CYS K    14                                                      
REMARK 465     TRP K    15                                                      
REMARK 465     ARG K    16                                                      
REMARK 465     LYS K    17                                                      
REMARK 465     ARG K    18                                                      
REMARK 465     VAL K    19                                                      
REMARK 465     LYS K    20                                                      
REMARK 465     SER K    21                                                      
REMARK 465     GLU K    22                                                      
REMARK 465     TYR K    23                                                      
REMARK 465     MET K    24                                                      
REMARK 465     ARG K    25                                                      
REMARK 465     LEU K    26                                                      
REMARK 465     ARG K    27                                                      
REMARK 465     GLN K    28                                                      
REMARK 465     LEU K    29                                                      
REMARK 465     LYS K    30                                                      
REMARK 465     ARG K    31                                                      
REMARK 465     PHE K    32                                                      
REMARK 465     ARG K    33                                                      
REMARK 465     ARG K    34                                                      
REMARK 465     ALA K    35                                                      
REMARK 465     ASP K    36                                                      
REMARK 465     GLU K    37                                                      
REMARK 465     VAL K    38                                                      
REMARK 465     LYS K    39                                                      
REMARK 465     SER K    40                                                      
REMARK 465     MET K    41                                                      
REMARK 465     PHE K    42                                                      
REMARK 465     SER K    43                                                      
REMARK 465     SER K    44                                                      
REMARK 465     ASN K    45                                                      
REMARK 465     ARG K    46                                                      
REMARK 465     GLN K    47                                                      
REMARK 465     LYS K    48                                                      
REMARK 465     ILE K    49                                                      
REMARK 465     LEU K    50                                                      
REMARK 465     GLU K    51                                                      
REMARK 465     ARG K    52                                                      
REMARK 465     THR K    53                                                      
REMARK 465     GLU K    54                                                      
REMARK 465     ILE K    55                                                      
REMARK 465     LEU K    56                                                      
REMARK 465     ASN K    57                                                      
REMARK 465     GLN K    58                                                      
REMARK 465     GLU K    59                                                      
REMARK 465     TRP K    60                                                      
REMARK 465     LYS K    61                                                      
REMARK 465     GLN K    62                                                      
REMARK 465     ARG K    63                                                      
REMARK 465     ARG K    64                                                      
REMARK 465     ILE K    65                                                      
REMARK 465     GLN K    66                                                      
REMARK 465     PRO K    67                                                      
REMARK 465     VAL K    68                                                      
REMARK 465     HIS K    69                                                      
REMARK 465     ILE K    70                                                      
REMARK 465     LEU K    71                                                      
REMARK 465     THR K    72                                                      
REMARK 465     SER K    73                                                      
REMARK 465     VAL K    74                                                      
REMARK 465     SER K    75                                                      
REMARK 465     SER K    76                                                      
REMARK 465     LEU K    77                                                      
REMARK 465     ARG K    78                                                      
REMARK 465     GLY K    79                                                      
REMARK 465     THR K    80                                                      
REMARK 465     ARG K    81                                                      
REMARK 465     GLU K    82                                                      
REMARK 465     CYS K    83                                                      
REMARK 465     SER K    84                                                      
REMARK 465     VAL K    85                                                      
REMARK 465     THR K    86                                                      
REMARK 465     SER K    87                                                      
REMARK 465     ASP K    88                                                      
REMARK 465     LEU K    89                                                      
REMARK 465     ASP K    90                                                      
REMARK 465     PHE K    91                                                      
REMARK 465     PRO K    92                                                      
REMARK 465     THR K    93                                                      
REMARK 465     GLN K    94                                                      
REMARK 465     VAL K    95                                                      
REMARK 465     ILE K    96                                                      
REMARK 465     PRO K    97                                                      
REMARK 465     LEU K    98                                                      
REMARK 465     LYS K    99                                                      
REMARK 465     THR K   100                                                      
REMARK 465     LEU K   101                                                      
REMARK 465     ASN K   102                                                      
REMARK 465     ALA K   103                                                      
REMARK 465     VAL K   104                                                      
REMARK 465     ALA K   105                                                      
REMARK 465     SER K   106                                                      
REMARK 465     VAL K   107                                                      
REMARK 465     PRO K   108                                                      
REMARK 465     ILE K   109                                                      
REMARK 465     MET K   110                                                      
REMARK 465     TYR K   111                                                      
REMARK 465     SER K   112                                                      
REMARK 465     TRP K   113                                                      
REMARK 465     SER K   114                                                      
REMARK 465     PRO K   115                                                      
REMARK 465     LEU K   116                                                      
REMARK 465     GLN K   117                                                      
REMARK 465     GLN K   118                                                      
REMARK 465     ASN K   119                                                      
REMARK 465     PHE K   120                                                      
REMARK 465     MET K   121                                                      
REMARK 465     VAL K   122                                                      
REMARK 465     GLU K   123                                                      
REMARK 465     ASP K   124                                                      
REMARK 465     GLU K   125                                                      
REMARK 465     THR K   126                                                      
REMARK 465     VAL K   127                                                      
REMARK 465     LEU K   128                                                      
REMARK 465     HIS K   129                                                      
REMARK 465     ASN K   130                                                      
REMARK 465     ILE K   131                                                      
REMARK 465     PRO K   132                                                      
REMARK 465     TYR K   133                                                      
REMARK 465     MET K   134                                                      
REMARK 465     GLY K   135                                                      
REMARK 465     ASP K   136                                                      
REMARK 465     GLU K   137                                                      
REMARK 465     VAL K   138                                                      
REMARK 465     LEU K   139                                                      
REMARK 465     ASP K   140                                                      
REMARK 465     GLN K   141                                                      
REMARK 465     ASP K   142                                                      
REMARK 465     GLY K   143                                                      
REMARK 465     THR K   144                                                      
REMARK 465     PHE K   145                                                      
REMARK 465     ILE K   146                                                      
REMARK 465     GLU K   147                                                      
REMARK 465     GLU K   148                                                      
REMARK 465     LEU K   149                                                      
REMARK 465     ILE K   150                                                      
REMARK 465     LYS K   151                                                      
REMARK 465     ASN K   152                                                      
REMARK 465     TYR K   153                                                      
REMARK 465     ASP K   154                                                      
REMARK 465     GLY K   155                                                      
REMARK 465     LYS K   156                                                      
REMARK 465     VAL K   157                                                      
REMARK 465     HIS K   158                                                      
REMARK 465     GLY K   159                                                      
REMARK 465     ASP K   160                                                      
REMARK 465     ARG K   161                                                      
REMARK 465     GLU K   162                                                      
REMARK 465     CYS K   163                                                      
REMARK 465     GLY K   164                                                      
REMARK 465     PHE K   165                                                      
REMARK 465     ILE K   166                                                      
REMARK 465     ASN K   167                                                      
REMARK 465     ASP K   168                                                      
REMARK 465     GLU K   169                                                      
REMARK 465     ILE K   170                                                      
REMARK 465     PHE K   171                                                      
REMARK 465     VAL K   172                                                      
REMARK 465     GLU K   173                                                      
REMARK 465     LEU K   174                                                      
REMARK 465     VAL K   175                                                      
REMARK 465     ASN K   176                                                      
REMARK 465     ALA K   177                                                      
REMARK 465     LEU K   178                                                      
REMARK 465     GLY K   179                                                      
REMARK 465     GLN K   180                                                      
REMARK 465     TYR K   181                                                      
REMARK 465     ASN K   182                                                      
REMARK 465     ASP K   183                                                      
REMARK 465     ASP K   184                                                      
REMARK 465     ASP K   185                                                      
REMARK 465     ASP K   186                                                      
REMARK 465     ASP K   187                                                      
REMARK 465     ASP K   188                                                      
REMARK 465     ASP K   189                                                      
REMARK 465     GLY K   190                                                      
REMARK 465     ASP K   191                                                      
REMARK 465     ASP K   192                                                      
REMARK 465     PRO K   193                                                      
REMARK 465     GLU K   194                                                      
REMARK 465     GLU K   195                                                      
REMARK 465     ARG K   196                                                      
REMARK 465     GLU K   197                                                      
REMARK 465     GLU K   198                                                      
REMARK 465     LYS K   199                                                      
REMARK 465     GLN K   200                                                      
REMARK 465     LYS K   201                                                      
REMARK 465     ASP K   202                                                      
REMARK 465     LEU K   203                                                      
REMARK 465     GLU K   204                                                      
REMARK 465     ASP K   205                                                      
REMARK 465     HIS K   206                                                      
REMARK 465     ARG K   207                                                      
REMARK 465     ASP K   208                                                      
REMARK 465     ASP K   209                                                      
REMARK 465     LYS K   210                                                      
REMARK 465     GLU K   211                                                      
REMARK 465     SER K   212                                                      
REMARK 465     ARG K   213                                                      
REMARK 465     PRO K   214                                                      
REMARK 465     PRO K   215                                                      
REMARK 465     ARG K   216                                                      
REMARK 465     LYS K   217                                                      
REMARK 465     PHE K   218                                                      
REMARK 465     PRO K   219                                                      
REMARK 465     SER K   220                                                      
REMARK 465     ASP K   221                                                      
REMARK 465     LYS K   222                                                      
REMARK 465     ILE K   223                                                      
REMARK 465     PHE K   224                                                      
REMARK 465     GLU K   225                                                      
REMARK 465     ALA K   226                                                      
REMARK 465     ILE K   227                                                      
REMARK 465     SER K   228                                                      
REMARK 465     SER K   229                                                      
REMARK 465     MET K   230                                                      
REMARK 465     PHE K   231                                                      
REMARK 465     PRO K   232                                                      
REMARK 465     ASP K   233                                                      
REMARK 465     LYS K   234                                                      
REMARK 465     GLY K   235                                                      
REMARK 465     THR K   236                                                      
REMARK 465     ALA K   237                                                      
REMARK 465     GLU K   238                                                      
REMARK 465     GLU K   239                                                      
REMARK 465     LEU K   240                                                      
REMARK 465     LYS K   241                                                      
REMARK 465     GLU K   242                                                      
REMARK 465     LYS K   243                                                      
REMARK 465     TYR K   244                                                      
REMARK 465     LYS K   245                                                      
REMARK 465     GLU K   246                                                      
REMARK 465     LEU K   247                                                      
REMARK 465     THR K   248                                                      
REMARK 465     GLU K   249                                                      
REMARK 465     GLN K   250                                                      
REMARK 465     GLN K   251                                                      
REMARK 465     LEU K   252                                                      
REMARK 465     PRO K   253                                                      
REMARK 465     GLY K   254                                                      
REMARK 465     ALA K   255                                                      
REMARK 465     LEU K   256                                                      
REMARK 465     PRO K   257                                                      
REMARK 465     PRO K   258                                                      
REMARK 465     LYS K   307                                                      
REMARK 465     ARG K   308                                                      
REMARK 465     LYS K   309                                                      
REMARK 465     ASN K   310                                                      
REMARK 465     THR K   311                                                      
REMARK 465     GLU K   312                                                      
REMARK 465     THR K   313                                                      
REMARK 465     ALA K   314                                                      
REMARK 465     LEU K   315                                                      
REMARK 465     ASP K   316                                                      
REMARK 465     ASN K   317                                                      
REMARK 465     LYS K   318                                                      
REMARK 465     PRO K   319                                                      
REMARK 465     CYS K   320                                                      
REMARK 465     GLY K   321                                                      
REMARK 465     PRO K   322                                                      
REMARK 465     GLN K   323                                                      
REMARK 465     CYS K   324                                                      
REMARK 465     TYR K   325                                                      
REMARK 465     GLN K   326                                                      
REMARK 465     HIS K   327                                                      
REMARK 465     LEU K   328                                                      
REMARK 465     GLU K   329                                                      
REMARK 465     GLY K   330                                                      
REMARK 465     ALA K   331                                                      
REMARK 465     LYS K   332                                                      
REMARK 465     GLU K   333                                                      
REMARK 465     PHE K   334                                                      
REMARK 465     ALA K   335                                                      
REMARK 465     ALA K   336                                                      
REMARK 465     ALA K   337                                                      
REMARK 465     LEU K   338                                                      
REMARK 465     THR K   339                                                      
REMARK 465     ALA K   340                                                      
REMARK 465     GLU K   341                                                      
REMARK 465     ARG K   342                                                      
REMARK 465     ILE K   343                                                      
REMARK 465     LYS K   344                                                      
REMARK 465     THR K   345                                                      
REMARK 465     PRO K   346                                                      
REMARK 465     PRO K   347                                                      
REMARK 465     LYS K   348                                                      
REMARK 465     ARG K   349                                                      
REMARK 465     PRO K   350                                                      
REMARK 465     GLY K   351                                                      
REMARK 465     GLY K   352                                                      
REMARK 465     ARG K   353                                                      
REMARK 465     ARG K   354                                                      
REMARK 465     ARG K   355                                                      
REMARK 465     GLY K   356                                                      
REMARK 465     ARG K   357                                                      
REMARK 465     LEU K   358                                                      
REMARK 465     PRO K   359                                                      
REMARK 465     ASN K   360                                                      
REMARK 465     ASN K   361                                                      
REMARK 465     SER K   362                                                      
REMARK 465     SER K   363                                                      
REMARK 465     ARG K   364                                                      
REMARK 465     PRO K   365                                                      
REMARK 465     SER K   366                                                      
REMARK 465     THR K   367                                                      
REMARK 465     PRO K   368                                                      
REMARK 465     THR K   369                                                      
REMARK 465     ILE K   370                                                      
REMARK 465     ASN K   371                                                      
REMARK 465     VAL K   372                                                      
REMARK 465     LEU K   373                                                      
REMARK 465     GLU K   374                                                      
REMARK 465     SER K   375                                                      
REMARK 465     LYS K   376                                                      
REMARK 465     ASP K   377                                                      
REMARK 465     THR K   378                                                      
REMARK 465     ASP K   379                                                      
REMARK 465     SER K   380                                                      
REMARK 465     ASP K   381                                                      
REMARK 465     ARG K   382                                                      
REMARK 465     GLU K   383                                                      
REMARK 465     ALA K   384                                                      
REMARK 465     GLY K   385                                                      
REMARK 465     THR K   386                                                      
REMARK 465     GLU K   387                                                      
REMARK 465     THR K   388                                                      
REMARK 465     GLY K   389                                                      
REMARK 465     GLY K   390                                                      
REMARK 465     GLU K   391                                                      
REMARK 465     ASN K   392                                                      
REMARK 465     ASN K   393                                                      
REMARK 465     ASP K   394                                                      
REMARK 465     LYS K   395                                                      
REMARK 465     GLU K   396                                                      
REMARK 465     GLU K   397                                                      
REMARK 465     GLU K   398                                                      
REMARK 465     GLU K   399                                                      
REMARK 465     LYS K   400                                                      
REMARK 465     LYS K   401                                                      
REMARK 465     ASP K   402                                                      
REMARK 465     GLU K   403                                                      
REMARK 465     THR K   404                                                      
REMARK 465     SER K   405                                                      
REMARK 465     SER K   406                                                      
REMARK 465     SER K   407                                                      
REMARK 465     SER K   408                                                      
REMARK 465     GLU K   409                                                      
REMARK 465     ALA K   410                                                      
REMARK 465     ASN K   411                                                      
REMARK 465     SER K   412                                                      
REMARK 465     ARG K   413                                                      
REMARK 465     CYS K   414                                                      
REMARK 465     GLN K   415                                                      
REMARK 465     THR K   416                                                      
REMARK 465     PRO K   417                                                      
REMARK 465     ILE K   418                                                      
REMARK 465     LYS K   419                                                      
REMARK 465     MET K   420                                                      
REMARK 465     LYS K   421                                                      
REMARK 465     PRO K   422                                                      
REMARK 465     ALA K   478                                                      
REMARK 465     PRO K   479                                                      
REMARK 465     ALA K   480                                                      
REMARK 465     PRO K   481                                                      
REMARK 465     ALA K   482                                                      
REMARK 465     GLU K   483                                                      
REMARK 465     ASP K   484                                                      
REMARK 465     VAL K   485                                                      
REMARK 465     ASP K   486                                                      
REMARK 465     THR K   487                                                      
REMARK 465     PRO K   488                                                      
REMARK 465     PRO K   489                                                      
REMARK 465     ARG K   490                                                      
REMARK 465     LYS K   491                                                      
REMARK 465     LYS K   492                                                      
REMARK 465     LYS K   493                                                      
REMARK 465     ARG K   494                                                      
REMARK 465     LYS K   495                                                      
REMARK 465     HIS K   496                                                      
REMARK 465     ARG K   497                                                      
REMARK 465     LEU K   498                                                      
REMARK 465     TRP K   499                                                      
REMARK 465     ALA K   500                                                      
REMARK 465     ALA K   501                                                      
REMARK 465     HIS K   502                                                      
REMARK 465     CYS K   503                                                      
REMARK 465     ARG K   504                                                      
REMARK 465     LYS K   505                                                      
REMARK 465     ILE K   506                                                      
REMARK 465     GLN K   507                                                      
REMARK 465     LEU K   508                                                      
REMARK 465     LYS K   509                                                      
REMARK 465     LYS K   510                                                      
REMARK 465     ASP K   511                                                      
REMARK 465     GLY K   512                                                      
REMARK 465     SER K   513                                                      
REMARK 465     TYR K   736                                                      
REMARK 465     VAL K   737                                                      
REMARK 465     GLY K   738                                                      
REMARK 465     ILE K   739                                                      
REMARK 465     GLU K   740                                                      
REMARK 465     ARG K   741                                                      
REMARK 465     GLU K   742                                                      
REMARK 465     MET K   743                                                      
REMARK 465     GLU K   744                                                      
REMARK 465     ILE K   745                                                      
REMARK 465     PRO K   746                                                      
REMARK 465     MET L     1                                                      
REMARK 465     SER L     2                                                      
REMARK 465     GLU L     3                                                      
REMARK 465     ARG L     4                                                      
REMARK 465     GLU L     5                                                      
REMARK 465     VAL L     6                                                      
REMARK 465     SER L     7                                                      
REMARK 465     THR L     8                                                      
REMARK 465     ALA L     9                                                      
REMARK 465     PRO L    10                                                      
REMARK 465     ALA L    11                                                      
REMARK 465     GLY L    12                                                      
REMARK 465     THR L    13                                                      
REMARK 465     ASP L    14                                                      
REMARK 465     MET L    15                                                      
REMARK 465     PRO L    16                                                      
REMARK 465     ALA L    17                                                      
REMARK 465     ALA L    18                                                      
REMARK 465     LYS L    19                                                      
REMARK 465     LYS L    20                                                      
REMARK 465     GLN L    21                                                      
REMARK 465     LYS L    22                                                      
REMARK 465     LEU L    23                                                      
REMARK 465     SER L    24                                                      
REMARK 465     SER L    25                                                      
REMARK 465     ASP L    26                                                      
REMARK 465     GLU L    27                                                      
REMARK 465     ASN L    28                                                      
REMARK 465     SER L    29                                                      
REMARK 465     ASN L    30                                                      
REMARK 465     PRO L    31                                                      
REMARK 465     ASP L    32                                                      
REMARK 465     LEU L    33                                                      
REMARK 465     SER L    34                                                      
REMARK 465     GLY L    35                                                      
REMARK 465     ASP L    36                                                      
REMARK 465     GLU L    37                                                      
REMARK 465     ASN L    38                                                      
REMARK 465     ASP L    39                                                      
REMARK 465     ASP L    40                                                      
REMARK 465     ALA L    41                                                      
REMARK 465     VAL L    42                                                      
REMARK 465     SER L    43                                                      
REMARK 465     ILE L    44                                                      
REMARK 465     GLU L    45                                                      
REMARK 465     SER L    46                                                      
REMARK 465     GLY L    47                                                      
REMARK 465     THR L    48                                                      
REMARK 465     ASN L    49                                                      
REMARK 465     THR L    50                                                      
REMARK 465     GLU L    51                                                      
REMARK 465     ARG L    52                                                      
REMARK 465     PRO L    53                                                      
REMARK 465     ASP L    54                                                      
REMARK 465     THR L    55                                                      
REMARK 465     PRO L    56                                                      
REMARK 465     THR L    57                                                      
REMARK 465     ASN L    58                                                      
REMARK 465     THR L    59                                                      
REMARK 465     PRO L    60                                                      
REMARK 465     ASN L    61                                                      
REMARK 465     ALA L    62                                                      
REMARK 465     PRO L    63                                                      
REMARK 465     GLY L    64                                                      
REMARK 465     ARG L    65                                                      
REMARK 465     LYS L    66                                                      
REMARK 465     SER L    67                                                      
REMARK 465     TRP L    68                                                      
REMARK 465     GLY L    69                                                      
REMARK 465     LYS L    70                                                      
REMARK 465     GLY L    71                                                      
REMARK 465     LYS L    72                                                      
REMARK 465     TRP L    73                                                      
REMARK 465     LYS L    74                                                      
REMARK 465     SER L    75                                                      
REMARK 465     LYS L    76                                                      
REMARK 465     LYS L    77                                                      
REMARK 465     CYS L    78                                                      
REMARK 465     LYS L    79                                                      
REMARK 465     MET M     1                                                      
REMARK 465     ALA M     2                                                      
REMARK 465     PRO M     3                                                      
REMARK 465     GLN M     4                                                      
REMARK 465     LYS M     5                                                      
REMARK 465     HIS M     6                                                      
REMARK 465     GLY M     7                                                      
REMARK 465     GLY M     8                                                      
REMARK 465     GLY M     9                                                      
REMARK 465     GLY M    10                                                      
REMARK 465     GLY M    11                                                      
REMARK 465     GLY M    12                                                      
REMARK 465     GLY M    13                                                      
REMARK 465     SER M    14                                                      
REMARK 465     GLY M    15                                                      
REMARK 465     PRO M    16                                                      
REMARK 465     SER M    17                                                      
REMARK 465     ALA M    18                                                      
REMARK 465     GLY M    19                                                      
REMARK 465     SER M    20                                                      
REMARK 465     GLY M    21                                                      
REMARK 465     GLY M    22                                                      
REMARK 465     GLY M    23                                                      
REMARK 465     GLY M    24                                                      
REMARK 465     PHE M    25                                                      
REMARK 465     GLY M    26                                                      
REMARK 465     GLY M    27                                                      
REMARK 465     SER M    28                                                      
REMARK 465     ALA M    29                                                      
REMARK 465     ALA M    30                                                      
REMARK 465     VAL M    31                                                      
REMARK 465     ALA M    32                                                      
REMARK 465     ALA M    33                                                      
REMARK 465     ALA M    34                                                      
REMARK 465     THR M    35                                                      
REMARK 465     ALA M    36                                                      
REMARK 465     SER M    37                                                      
REMARK 465     GLY M    38                                                      
REMARK 465     GLY M    39                                                      
REMARK 465     LYS M    40                                                      
REMARK 465     SER M    41                                                      
REMARK 465     GLY M    42                                                      
REMARK 465     GLY M    43                                                      
REMARK 465     GLY M    44                                                      
REMARK 465     SER M    45                                                      
REMARK 465     CYS M    46                                                      
REMARK 465     GLY M    47                                                      
REMARK 465     GLY M    48                                                      
REMARK 465     GLY M    49                                                      
REMARK 465     GLY M    50                                                      
REMARK 465     SER M    51                                                      
REMARK 465     TYR M    52                                                      
REMARK 465     SER M    53                                                      
REMARK 465     ALA M    54                                                      
REMARK 465     SER M    55                                                      
REMARK 465     SER M    56                                                      
REMARK 465     SER M    57                                                      
REMARK 465     SER M    58                                                      
REMARK 465     SER M    59                                                      
REMARK 465     ALA M    60                                                      
REMARK 465     ALA M    61                                                      
REMARK 465     ALA M    62                                                      
REMARK 465     ALA M    63                                                      
REMARK 465     ALA M    64                                                      
REMARK 465     GLY M    65                                                      
REMARK 465     ALA M    66                                                      
REMARK 465     ALA M    67                                                      
REMARK 465     VAL M    68                                                      
REMARK 465     LEU M    69                                                      
REMARK 465     PRO M    70                                                      
REMARK 465     VAL M    71                                                      
REMARK 465     LYS M    72                                                      
REMARK 465     LYS M    73                                                      
REMARK 465     PRO M    74                                                      
REMARK 465     LYS M    75                                                      
REMARK 465     MET M    76                                                      
REMARK 465     GLU M    77                                                      
REMARK 465     HIS M    78                                                      
REMARK 465     VAL M    79                                                      
REMARK 465     GLN M    80                                                      
REMARK 465     ALA M    81                                                      
REMARK 465     ASP M    82                                                      
REMARK 465     HIS M    83                                                      
REMARK 465     GLU M    84                                                      
REMARK 465     LEU M    85                                                      
REMARK 465     PHE M    86                                                      
REMARK 465     LEU M    87                                                      
REMARK 465     GLN M    88                                                      
REMARK 465     ALA M    89                                                      
REMARK 465     PHE M    90                                                      
REMARK 465     GLU M    91                                                      
REMARK 465     LYS M    92                                                      
REMARK 465     PRO M    93                                                      
REMARK 465     THR M    94                                                      
REMARK 465     GLN M    95                                                      
REMARK 465     ILE M    96                                                      
REMARK 465     TYR M    97                                                      
REMARK 465     ARG M    98                                                      
REMARK 465     PHE M    99                                                      
REMARK 465     LEU M   100                                                      
REMARK 465     ARG M   101                                                      
REMARK 465     THR M   102                                                      
REMARK 465     ARG M   103                                                      
REMARK 465     ASN M   104                                                      
REMARK 465     LEU M   105                                                      
REMARK 465     ILE M   106                                                      
REMARK 465     ALA M   107                                                      
REMARK 465     PRO M   108                                                      
REMARK 465     ILE M   109                                                      
REMARK 465     PHE M   110                                                      
REMARK 465     LEU M   111                                                      
REMARK 465     HIS M   112                                                      
REMARK 465     ARG M   113                                                      
REMARK 465     THR M   114                                                      
REMARK 465     LEU M   115                                                      
REMARK 465     THR M   116                                                      
REMARK 465     TYR M   117                                                      
REMARK 465     MET M   118                                                      
REMARK 465     SER M   119                                                      
REMARK 465     HIS M   120                                                      
REMARK 465     ARG M   121                                                      
REMARK 465     ASN M   122                                                      
REMARK 465     SER M   123                                                      
REMARK 465     ARG M   124                                                      
REMARK 465     THR M   125                                                      
REMARK 465     ASN M   126                                                      
REMARK 465     ILE M   127                                                      
REMARK 465     LYS M   128                                                      
REMARK 465     ARG M   129                                                      
REMARK 465     LYS M   130                                                      
REMARK 465     THR M   131                                                      
REMARK 465     PHE M   132                                                      
REMARK 465     LYS M   133                                                      
REMARK 465     VAL M   134                                                      
REMARK 465     ASP M   135                                                      
REMARK 465     ASP M   136                                                      
REMARK 465     MET M   137                                                      
REMARK 465     LEU M   138                                                      
REMARK 465     SER M   139                                                      
REMARK 465     LYS M   140                                                      
REMARK 465     VAL M   141                                                      
REMARK 465     GLU M   142                                                      
REMARK 465     LYS M   143                                                      
REMARK 465     MET M   144                                                      
REMARK 465     LYS M   145                                                      
REMARK 465     GLY M   146                                                      
REMARK 465     GLU M   147                                                      
REMARK 465     GLN M   148                                                      
REMARK 465     GLU M   149                                                      
REMARK 465     SER M   150                                                      
REMARK 465     HIS M   151                                                      
REMARK 465     SER M   152                                                      
REMARK 465     LEU M   153                                                      
REMARK 465     SER M   154                                                      
REMARK 465     ALA M   155                                                      
REMARK 465     HIS M   156                                                      
REMARK 465     LEU M   157                                                      
REMARK 465     GLN M   158                                                      
REMARK 465     LEU M   159                                                      
REMARK 465     THR M   160                                                      
REMARK 465     PHE M   161                                                      
REMARK 465     THR M   162                                                      
REMARK 465     GLY M   163                                                      
REMARK 465     PHE M   164                                                      
REMARK 465     PHE M   165                                                      
REMARK 465     HIS M   166                                                      
REMARK 465     LYS M   167                                                      
REMARK 465     ASN M   168                                                      
REMARK 465     ASP M   169                                                      
REMARK 465     LYS M   170                                                      
REMARK 465     PRO M   171                                                      
REMARK 465     SER M   172                                                      
REMARK 465     PRO M   173                                                      
REMARK 465     ASN M   174                                                      
REMARK 465     SER M   175                                                      
REMARK 465     GLU M   176                                                      
REMARK 465     ASN M   177                                                      
REMARK 465     GLU M   178                                                      
REMARK 465     GLN M   179                                                      
REMARK 465     ASN M   180                                                      
REMARK 465     SER M   181                                                      
REMARK 465     VAL M   182                                                      
REMARK 465     THR M   183                                                      
REMARK 465     LEU M   184                                                      
REMARK 465     GLU M   185                                                      
REMARK 465     VAL M   186                                                      
REMARK 465     LEU M   187                                                      
REMARK 465     LEU M   188                                                      
REMARK 465     VAL M   189                                                      
REMARK 465     LYS M   190                                                      
REMARK 465     VAL M   191                                                      
REMARK 465     CYS M   192                                                      
REMARK 465     HIS M   193                                                      
REMARK 465     LYS M   194                                                      
REMARK 465     LYS M   195                                                      
REMARK 465     ARG M   196                                                      
REMARK 465     LYS M   197                                                      
REMARK 465     ASP M   198                                                      
REMARK 465     VAL M   199                                                      
REMARK 465     SER M   200                                                      
REMARK 465     CYS M   201                                                      
REMARK 465     PRO M   202                                                      
REMARK 465     ILE M   203                                                      
REMARK 465     ARG M   204                                                      
REMARK 465     GLN M   205                                                      
REMARK 465     VAL M   206                                                      
REMARK 465     PRO M   207                                                      
REMARK 465     THR M   208                                                      
REMARK 465     GLY M   209                                                      
REMARK 465     LYS M   210                                                      
REMARK 465     LYS M   211                                                      
REMARK 465     GLN M   212                                                      
REMARK 465     VAL M   213                                                      
REMARK 465     PRO M   214                                                      
REMARK 465     LEU M   215                                                      
REMARK 465     ASN M   216                                                      
REMARK 465     PRO M   217                                                      
REMARK 465     ASP M   218                                                      
REMARK 465     LEU M   219                                                      
REMARK 465     ASN M   220                                                      
REMARK 465     GLN M   221                                                      
REMARK 465     THR M   222                                                      
REMARK 465     LYS M   223                                                      
REMARK 465     PRO M   224                                                      
REMARK 465     GLY M   225                                                      
REMARK 465     ASN M   226                                                      
REMARK 465     PHE M   227                                                      
REMARK 465     PRO M   228                                                      
REMARK 465     SER M   229                                                      
REMARK 465     LEU M   230                                                      
REMARK 465     ALA M   231                                                      
REMARK 465     VAL M   232                                                      
REMARK 465     SER M   233                                                      
REMARK 465     SER M   234                                                      
REMARK 465     ASN M   235                                                      
REMARK 465     GLU M   236                                                      
REMARK 465     PHE M   237                                                      
REMARK 465     GLU M   238                                                      
REMARK 465     PRO M   239                                                      
REMARK 465     SER M   240                                                      
REMARK 465     ASN M   241                                                      
REMARK 465     SER M   242                                                      
REMARK 465     HIS M   243                                                      
REMARK 465     MET M   244                                                      
REMARK 465     VAL M   245                                                      
REMARK 465     LYS M   246                                                      
REMARK 465     SER M   247                                                      
REMARK 465     TYR M   248                                                      
REMARK 465     SER M   249                                                      
REMARK 465     LEU M   250                                                      
REMARK 465     LEU M   251                                                      
REMARK 465     PHE M   252                                                      
REMARK 465     ARG M   253                                                      
REMARK 465     VAL M   254                                                      
REMARK 465     THR M   255                                                      
REMARK 465     ARG M   256                                                      
REMARK 465     PRO M   257                                                      
REMARK 465     GLY M   258                                                      
REMARK 465     ARG M   259                                                      
REMARK 465     ARG M   260                                                      
REMARK 465     GLU M   261                                                      
REMARK 465     PHE M   262                                                      
REMARK 465     ASN M   263                                                      
REMARK 465     GLY M   264                                                      
REMARK 465     MET M   265                                                      
REMARK 465     ILE M   266                                                      
REMARK 465     ASN M   267                                                      
REMARK 465     GLY M   268                                                      
REMARK 465     GLU M   269                                                      
REMARK 465     THR M   270                                                      
REMARK 465     ASN M   271                                                      
REMARK 465     GLU M   272                                                      
REMARK 465     ASN M   273                                                      
REMARK 465     ILE M   274                                                      
REMARK 465     ASP M   275                                                      
REMARK 465     VAL M   276                                                      
REMARK 465     ASN M   277                                                      
REMARK 465     GLU M   278                                                      
REMARK 465     GLU M   279                                                      
REMARK 465     LEU M   280                                                      
REMARK 465     PRO M   281                                                      
REMARK 465     ALA M   282                                                      
REMARK 465     ARG M   283                                                      
REMARK 465     ARG M   284                                                      
REMARK 465     LYS M   285                                                      
REMARK 465     ARG M   286                                                      
REMARK 465     ASN M   287                                                      
REMARK 465     ARG M   288                                                      
REMARK 465     GLU M   289                                                      
REMARK 465     ASP M   290                                                      
REMARK 465     GLY M   291                                                      
REMARK 465     GLU M   292                                                      
REMARK 465     LYS M   293                                                      
REMARK 465     THR M   294                                                      
REMARK 465     PHE M   295                                                      
REMARK 465     VAL M   296                                                      
REMARK 465     ALA M   297                                                      
REMARK 465     GLN M   298                                                      
REMARK 465     MET M   299                                                      
REMARK 465     THR M   300                                                      
REMARK 465     VAL M   301                                                      
REMARK 465     PHE M   302                                                      
REMARK 465     ASP M   303                                                      
REMARK 465     LYS M   304                                                      
REMARK 465     ASN M   305                                                      
REMARK 465     ARG M   306                                                      
REMARK 465     ARG M   307                                                      
REMARK 465     LEU M   308                                                      
REMARK 465     GLN M   309                                                      
REMARK 465     LEU M   310                                                      
REMARK 465     LEU M   311                                                      
REMARK 465     ASP M   312                                                      
REMARK 465     GLY M   313                                                      
REMARK 465     GLU M   314                                                      
REMARK 465     TYR M   315                                                      
REMARK 465     GLU M   316                                                      
REMARK 465     VAL M   317                                                      
REMARK 465     ALA M   318                                                      
REMARK 465     MET M   319                                                      
REMARK 465     GLN M   320                                                      
REMARK 465     GLU M   321                                                      
REMARK 465     MET M   322                                                      
REMARK 465     GLU M   323                                                      
REMARK 465     GLU M   324                                                      
REMARK 465     CYS M   325                                                      
REMARK 465     PRO M   326                                                      
REMARK 465     ILE M   327                                                      
REMARK 465     SER M   328                                                      
REMARK 465     LYS M   329                                                      
REMARK 465     LYS M   330                                                      
REMARK 465     ARG M   331                                                      
REMARK 465     ALA M   332                                                      
REMARK 465     THR M   333                                                      
REMARK 465     TRP M   334                                                      
REMARK 465     GLU M   335                                                      
REMARK 465     THR M   336                                                      
REMARK 465     ILE M   337                                                      
REMARK 465     LEU M   338                                                      
REMARK 465     ASP M   339                                                      
REMARK 465     GLY M   340                                                      
REMARK 465     LYS M   341                                                      
REMARK 465     ARG M   342                                                      
REMARK 465     LEU M   343                                                      
REMARK 465     PRO M   344                                                      
REMARK 465     PRO M   345                                                      
REMARK 465     PHE M   346                                                      
REMARK 465     GLU M   347                                                      
REMARK 465     THR M   348                                                      
REMARK 465     PHE M   349                                                      
REMARK 465     SER M   350                                                      
REMARK 465     GLN M   351                                                      
REMARK 465     GLY M   352                                                      
REMARK 465     PRO M   353                                                      
REMARK 465     THR M   354                                                      
REMARK 465     LEU M   355                                                      
REMARK 465     GLN M   356                                                      
REMARK 465     PHE M   357                                                      
REMARK 465     THR M   358                                                      
REMARK 465     LEU M   359                                                      
REMARK 465     ARG M   360                                                      
REMARK 465     TRP M   361                                                      
REMARK 465     THR M   362                                                      
REMARK 465     GLY M   363                                                      
REMARK 465     GLU M   364                                                      
REMARK 465     THR M   365                                                      
REMARK 465     ASN M   366                                                      
REMARK 465     ASP M   367                                                      
REMARK 465     LYS M   368                                                      
REMARK 465     SER M   369                                                      
REMARK 465     THR M   370                                                      
REMARK 465     ALA M   371                                                      
REMARK 465     PRO M   372                                                      
REMARK 465     ILE M   373                                                      
REMARK 465     ALA M   374                                                      
REMARK 465     LYS M   375                                                      
REMARK 465     PRO M   376                                                      
REMARK 465     LEU M   377                                                      
REMARK 465     ALA M   378                                                      
REMARK 465     THR M   379                                                      
REMARK 465     ARG M   380                                                      
REMARK 465     ASN M   381                                                      
REMARK 465     SER M   382                                                      
REMARK 465     GLU M   383                                                      
REMARK 465     SER M   384                                                      
REMARK 465     LEU M   385                                                      
REMARK 465     HIS M   386                                                      
REMARK 465     GLN M   387                                                      
REMARK 465     GLU M   388                                                      
REMARK 465     ASN M   389                                                      
REMARK 465     LYS M   390                                                      
REMARK 465     PRO M   391                                                      
REMARK 465     GLY M   392                                                      
REMARK 465     SER M   393                                                      
REMARK 465     VAL M   394                                                      
REMARK 465     LYS M   395                                                      
REMARK 465     PRO M   396                                                      
REMARK 465     THR M   397                                                      
REMARK 465     GLN M   398                                                      
REMARK 465     THR M   399                                                      
REMARK 465     ILE M   400                                                      
REMARK 465     ALA M   401                                                      
REMARK 465     VAL M   402                                                      
REMARK 465     LYS M   403                                                      
REMARK 465     GLU M   404                                                      
REMARK 465     SER M   405                                                      
REMARK 465     LEU M   406                                                      
REMARK 465     THR M   407                                                      
REMARK 465     THR M   408                                                      
REMARK 465     ASP M   409                                                      
REMARK 465     LEU M   410                                                      
REMARK 465     GLN M   411                                                      
REMARK 465     THR M   412                                                      
REMARK 465     ARG M   413                                                      
REMARK 465     LYS M   414                                                      
REMARK 465     GLU M   415                                                      
REMARK 465     LYS M   416                                                      
REMARK 465     ASP M   417                                                      
REMARK 465     THR M   418                                                      
REMARK 465     PRO M   419                                                      
REMARK 465     ASN M   420                                                      
REMARK 465     GLU M   421                                                      
REMARK 465     ASN M   422                                                      
REMARK 465     ARG M   423                                                      
REMARK 465     GLN M   424                                                      
REMARK 465     LYS M   425                                                      
REMARK 465     LEU M   426                                                      
REMARK 465     ARG M   427                                                      
REMARK 465     ILE M   428                                                      
REMARK 465     PHE M   429                                                      
REMARK 465     TYR M   430                                                      
REMARK 465     GLN M   431                                                      
REMARK 465     PHE M   432                                                      
REMARK 465     LEU M   433                                                      
REMARK 465     TYR M   434                                                      
REMARK 465     ASN M   435                                                      
REMARK 465     ASN M   436                                                      
REMARK 465     ASN M   437                                                      
REMARK 465     THR M   438                                                      
REMARK 465     ARG M   439                                                      
REMARK 465     GLN M   440                                                      
REMARK 465     GLN M   441                                                      
REMARK 465     THR M   442                                                      
REMARK 465     GLU M   443                                                      
REMARK 465     ALA M   444                                                      
REMARK 465     ARG M   445                                                      
REMARK 465     ASP M   446                                                      
REMARK 465     ASP M   447                                                      
REMARK 465     LEU M   448                                                      
REMARK 465     HIS M   449                                                      
REMARK 465     CYS M   450                                                      
REMARK 465     PRO M   451                                                      
REMARK 465     TRP M   452                                                      
REMARK 465     CYS M   453                                                      
REMARK 465     THR M   454                                                      
REMARK 465     LEU M   455                                                      
REMARK 465     ASN M   456                                                      
REMARK 465     CYS M   457                                                      
REMARK 465     ARG M   458                                                      
REMARK 465     LYS M   459                                                      
REMARK 465     LEU M   460                                                      
REMARK 465     TYR M   461                                                      
REMARK 465     SER M   462                                                      
REMARK 465     LEU M   463                                                      
REMARK 465     LEU M   464                                                      
REMARK 465     LYS M   465                                                      
REMARK 465     HIS M   466                                                      
REMARK 465     LEU M   467                                                      
REMARK 465     LYS M   468                                                      
REMARK 465     LEU M   469                                                      
REMARK 465     CYS M   470                                                      
REMARK 465     HIS M   471                                                      
REMARK 465     SER M   472                                                      
REMARK 465     ARG M   473                                                      
REMARK 465     PHE M   474                                                      
REMARK 465     ILE M   475                                                      
REMARK 465     PHE M   476                                                      
REMARK 465     ASN M   477                                                      
REMARK 465     TYR M   478                                                      
REMARK 465     VAL M   479                                                      
REMARK 465     TYR M   480                                                      
REMARK 465     HIS M   481                                                      
REMARK 465     PRO M   482                                                      
REMARK 465     LYS M   483                                                      
REMARK 465     GLY M   484                                                      
REMARK 465     ALA M   485                                                      
REMARK 465     ARG M   486                                                      
REMARK 465     ILE M   487                                                      
REMARK 465     ASP M   488                                                      
REMARK 465     VAL M   489                                                      
REMARK 465     SER M   490                                                      
REMARK 465     ILE M   491                                                      
REMARK 465     ASN M   492                                                      
REMARK 465     GLU M   493                                                      
REMARK 465     CYS M   494                                                      
REMARK 465     TYR M   495                                                      
REMARK 465     ASP M   496                                                      
REMARK 465     GLY M   497                                                      
REMARK 465     SER M   498                                                      
REMARK 465     TYR M   499                                                      
REMARK 465     ALA M   500                                                      
REMARK 465     GLY M   501                                                      
REMARK 465     ASN M   502                                                      
REMARK 465     PRO M   503                                                      
REMARK 465     GLN M   504                                                      
REMARK 465     ASP M   505                                                      
REMARK 465     ILE M   506                                                      
REMARK 465     HIS M   507                                                      
REMARK 465     ARG M   508                                                      
REMARK 465     GLN M   509                                                      
REMARK 465     PRO M   510                                                      
REMARK 465     GLY M   511                                                      
REMARK 465     PHE M   512                                                      
REMARK 465     ALA M   513                                                      
REMARK 465     PHE M   514                                                      
REMARK 465     SER M   515                                                      
REMARK 465     ARG M   516                                                      
REMARK 465     ASN M   517                                                      
REMARK 465     GLY M   518                                                      
REMARK 465     PRO M   519                                                      
REMARK 465     VAL M   520                                                      
REMARK 465     LYS M   521                                                      
REMARK 465     ARG M   522                                                      
REMARK 465     THR M   523                                                      
REMARK 465     PRO M   524                                                      
REMARK 465     ILE M   525                                                      
REMARK 465     THR M   526                                                      
REMARK 465     HIS M   527                                                      
REMARK 465     ILE M   528                                                      
REMARK 465     LEU M   529                                                      
REMARK 465     VAL M   530                                                      
REMARK 465     CYS M   531                                                      
REMARK 465     ARG M   532                                                      
REMARK 465     PRO M   533                                                      
REMARK 465     LYS M   534                                                      
REMARK 465     ARG M   535                                                      
REMARK 465     THR M   536                                                      
REMARK 465     LYS M   537                                                      
REMARK 465     ALA M   538                                                      
REMARK 465     SER M   539                                                      
REMARK 465     MET M   540                                                      
REMARK 465     SER M   541                                                      
REMARK 465     GLU M   542                                                      
REMARK 465     PHE M   543                                                      
REMARK 465     LEU M   544                                                      
REMARK 465     GLU M   545                                                      
REMARK 465     SER M   546                                                      
REMARK 465     GLU M   547                                                      
REMARK 465     ASP M   548                                                      
REMARK 465     GLY M   549                                                      
REMARK 465     GLU M   550                                                      
REMARK 465     VAL M   551                                                      
REMARK 465     GLU M   552                                                      
REMARK 465     GLN M   553                                                      
REMARK 465     GLN M   554                                                      
REMARK 465     ARG M   555                                                      
REMARK 465     THR M   556                                                      
REMARK 465     TYR M   557                                                      
REMARK 465     SER M   558                                                      
REMARK 465     SER M   559                                                      
REMARK 465     GLY M   560                                                      
REMARK 465     GLU M   683                                                      
REMARK 465     MET M   684                                                      
REMARK 465     GLN M   685                                                      
REMARK 465     GLN M   686                                                      
REMARK 465     LYS M   687                                                      
REMARK 465     LEU M   688                                                      
REMARK 465     GLU M   689                                                      
REMARK 465     LYS M   690                                                      
REMARK 465     GLY M   691                                                      
REMARK 465     GLU M   692                                                      
REMARK 465     SER M   693                                                      
REMARK 465     ALA M   694                                                      
REMARK 465     SER M   695                                                      
REMARK 465     PRO M   696                                                      
REMARK 465     ALA M   697                                                      
REMARK 465     ASN M   698                                                      
REMARK 465     GLU M   699                                                      
REMARK 465     GLU M   700                                                      
REMARK 465     ILE M   701                                                      
REMARK 465     THR M   702                                                      
REMARK 465     GLU M   703                                                      
REMARK 465     GLU M   704                                                      
REMARK 465     GLN M   705                                                      
REMARK 465     ASN M   706                                                      
REMARK 465     GLY M   707                                                      
REMARK 465     THR M   708                                                      
REMARK 465     ALA M   709                                                      
REMARK 465     ASN M   710                                                      
REMARK 465     GLY M   711                                                      
REMARK 465     PHE M   712                                                      
REMARK 465     SER M   713                                                      
REMARK 465     GLU M   714                                                      
REMARK 465     ILE M   715                                                      
REMARK 465     ASN M   716                                                      
REMARK 465     SER M   717                                                      
REMARK 465     LYS M   718                                                      
REMARK 465     GLU M   719                                                      
REMARK 465     LYS M   720                                                      
REMARK 465     ALA M   721                                                      
REMARK 465     LEU M   722                                                      
REMARK 465     GLU M   723                                                      
REMARK 465     THR M   724                                                      
REMARK 465     ASP M   725                                                      
REMARK 465     SER M   726                                                      
REMARK 465     VAL M   727                                                      
REMARK 465     SER M   728                                                      
REMARK 465     GLY M   729                                                      
REMARK 465     VAL M   730                                                      
REMARK 465     SER M   731                                                      
REMARK 465     LYS M   732                                                      
REMARK 465     GLN M   733                                                      
REMARK 465     SER M   734                                                      
REMARK 465     LYS M   735                                                      
REMARK 465     LYS M   736                                                      
REMARK 465     GLN M   737                                                      
REMARK 465     LYS M   738                                                      
REMARK 465     LEU M   739                                                      
REMARK 465     MET N     1                                                      
REMARK 465     ALA N     2                                                      
REMARK 465     ASP N     3                                                      
REMARK 465     ALA N    91                                                      
REMARK 465     GLN N    92                                                      
REMARK 465     PHE N    93                                                      
REMARK 465     ASP N    94                                                      
REMARK 465     ALA N    95                                                      
REMARK 465     SER N    96                                                      
REMARK 465     HIS N    97                                                      
REMARK 465     TYR N    98                                                      
REMARK 465     ASP N    99                                                      
REMARK 465     SER N   100                                                      
REMARK 465     GLU N   101                                                      
REMARK 465     LYS N   102                                                      
REMARK 465     GLY N   103                                                      
REMARK 465     GLU N   104                                                      
REMARK 465     PHE N   105                                                      
REMARK 465     GLY N   106                                                      
REMARK 465     GLY N   107                                                      
REMARK 465     PHE N   108                                                      
REMARK 465     GLY N   109                                                      
REMARK 465     SER N   110                                                      
REMARK 465     VAL N   111                                                      
REMARK 465     ASP N   411                                                      
REMARK 465     GLU N   412                                                      
REMARK 465     ASP N   413                                                      
REMARK 465     PRO N   414                                                      
REMARK 465     GLU N   415                                                      
REMARK 465     GLY N   416                                                      
REMARK 465     SER N   417                                                      
REMARK 465     VAL N   418                                                      
REMARK 465     ASP N   419                                                      
REMARK 465     PRO N   420                                                      
REMARK 465     GLU N   421                                                      
REMARK 465     GLY N   422                                                      
REMARK 465     GLN N   423                                                      
REMARK 465     GLY N   424                                                      
REMARK 465     SER N   425                                                      
REMARK 465     MET P     1                                                      
REMARK 465     SER P     2                                                      
REMARK 465     SER P     3                                                      
REMARK 465     ASP P     4                                                      
REMARK 465     GLY P     5                                                      
REMARK 465     GLU P     6                                                      
REMARK 465     PRO P     7                                                      
REMARK 465     LEU P     8                                                      
REMARK 465     SER P     9                                                      
REMARK 465     ARG P    10                                                      
REMARK 465     MET P    11                                                      
REMARK 465     ASP P    12                                                      
REMARK 465     SER P    13                                                      
REMARK 465     GLU P    14                                                      
REMARK 465     ASP P    15                                                      
REMARK 465     SER P    16                                                      
REMARK 465     ILE P    17                                                      
REMARK 465     SER P    18                                                      
REMARK 465     SER P    19                                                      
REMARK 465     THR P    20                                                      
REMARK 465     ILE P    21                                                      
REMARK 465     MET P    22                                                      
REMARK 465     ASP P    23                                                      
REMARK 465     VAL P    24                                                      
REMARK 465     ASP P    25                                                      
REMARK 465     SER P    26                                                      
REMARK 465     THR P    27                                                      
REMARK 465     ILE P    28                                                      
REMARK 465     SER P    29                                                      
REMARK 465     SER P    30                                                      
REMARK 465     GLY P    31                                                      
REMARK 465     ARG P    32                                                      
REMARK 465     SER P    33                                                      
REMARK 465     THR P    34                                                      
REMARK 465     PRO P    35                                                      
REMARK 465     ALA P    36                                                      
REMARK 465     MET P    37                                                      
REMARK 465     MET P    38                                                      
REMARK 465     ASN P    39                                                      
REMARK 465     GLY P    40                                                      
REMARK 465     GLN P    41                                                      
REMARK 465     GLY P    42                                                      
REMARK 465     SER P    43                                                      
REMARK 465     THR P    44                                                      
REMARK 465     THR P    45                                                      
REMARK 465     SER P    46                                                      
REMARK 465     SER P    47                                                      
REMARK 465     SER P    48                                                      
REMARK 465     LYS P    49                                                      
REMARK 465     ASN P    50                                                      
REMARK 465     ILE P    51                                                      
REMARK 465     ALA P    52                                                      
REMARK 465     TYR P    53                                                      
REMARK 465     ASN P    54                                                      
REMARK 465     CYS P    55                                                      
REMARK 465     CYS P    56                                                      
REMARK 465     TRP P    57                                                      
REMARK 465     ASP P    58                                                      
REMARK 465     GLN P    59                                                      
REMARK 465     CYS P    60                                                      
REMARK 465     GLN P    61                                                      
REMARK 465     ALA P    62                                                      
REMARK 465     CYS P    63                                                      
REMARK 465     PHE P    64                                                      
REMARK 465     ASN P    65                                                      
REMARK 465     SER P    66                                                      
REMARK 465     SER P    67                                                      
REMARK 465     PRO P    68                                                      
REMARK 465     ASP P    69                                                      
REMARK 465     LEU P    70                                                      
REMARK 465     ALA P    71                                                      
REMARK 465     ASP P    72                                                      
REMARK 465     HIS P    73                                                      
REMARK 465     ILE P    74                                                      
REMARK 465     ARG P    75                                                      
REMARK 465     SER P    76                                                      
REMARK 465     ILE P    77                                                      
REMARK 465     HIS P    78                                                      
REMARK 465     VAL P    79                                                      
REMARK 465     ASP P    80                                                      
REMARK 465     GLY P    81                                                      
REMARK 465     GLN P    82                                                      
REMARK 465     ARG P    83                                                      
REMARK 465     GLY P    84                                                      
REMARK 465     GLY P    85                                                      
REMARK 465     VAL P    86                                                      
REMARK 465     PHE P    87                                                      
REMARK 465     VAL P    88                                                      
REMARK 465     CYS P    89                                                      
REMARK 465     LEU P    90                                                      
REMARK 465     TRP P    91                                                      
REMARK 465     LYS P    92                                                      
REMARK 465     GLY P    93                                                      
REMARK 465     CYS P    94                                                      
REMARK 465     LYS P    95                                                      
REMARK 465     VAL P    96                                                      
REMARK 465     TYR P    97                                                      
REMARK 465     ASN P    98                                                      
REMARK 465     THR P    99                                                      
REMARK 465     PRO P   100                                                      
REMARK 465     SER P   101                                                      
REMARK 465     THR P   102                                                      
REMARK 465     SER P   103                                                      
REMARK 465     GLN P   104                                                      
REMARK 465     SER P   105                                                      
REMARK 465     TRP P   106                                                      
REMARK 465     LEU P   107                                                      
REMARK 465     GLN P   108                                                      
REMARK 465     ARG P   109                                                      
REMARK 465     HIS P   110                                                      
REMARK 465     MET P   111                                                      
REMARK 465     LEU P   112                                                      
REMARK 465     THR P   113                                                      
REMARK 465     HIS P   114                                                      
REMARK 465     SER P   115                                                      
REMARK 465     GLY P   116                                                      
REMARK 465     ASP P   117                                                      
REMARK 465     LYS P   118                                                      
REMARK 465     PRO P   119                                                      
REMARK 465     PHE P   120                                                      
REMARK 465     LYS P   121                                                      
REMARK 465     CYS P   122                                                      
REMARK 465     VAL P   123                                                      
REMARK 465     VAL P   124                                                      
REMARK 465     GLY P   125                                                      
REMARK 465     GLY P   126                                                      
REMARK 465     CYS P   127                                                      
REMARK 465     ASN P   128                                                      
REMARK 465     ALA P   129                                                      
REMARK 465     SER P   130                                                      
REMARK 465     PHE P   131                                                      
REMARK 465     ALA P   132                                                      
REMARK 465     SER P   133                                                      
REMARK 465     GLN P   134                                                      
REMARK 465     GLY P   135                                                      
REMARK 465     GLY P   136                                                      
REMARK 465     LEU P   137                                                      
REMARK 465     ALA P   138                                                      
REMARK 465     ARG P   139                                                      
REMARK 465     HIS P   140                                                      
REMARK 465     VAL P   141                                                      
REMARK 465     PRO P   142                                                      
REMARK 465     THR P   143                                                      
REMARK 465     HIS P   144                                                      
REMARK 465     PHE P   145                                                      
REMARK 465     SER P   146                                                      
REMARK 465     GLN P   147                                                      
REMARK 465     GLN P   148                                                      
REMARK 465     ASN P   149                                                      
REMARK 465     SER P   150                                                      
REMARK 465     SER P   151                                                      
REMARK 465     LYS P   152                                                      
REMARK 465     VAL P   153                                                      
REMARK 465     SER P   154                                                      
REMARK 465     SER P   155                                                      
REMARK 465     GLN P   156                                                      
REMARK 465     PRO P   157                                                      
REMARK 465     LYS P   158                                                      
REMARK 465     ALA P   159                                                      
REMARK 465     LYS P   160                                                      
REMARK 465     GLU P   161                                                      
REMARK 465     GLU P   162                                                      
REMARK 465     SER P   163                                                      
REMARK 465     PRO P   164                                                      
REMARK 465     SER P   165                                                      
REMARK 465     LYS P   166                                                      
REMARK 465     ALA P   167                                                      
REMARK 465     GLY P   168                                                      
REMARK 465     MET P   169                                                      
REMARK 465     ASN P   170                                                      
REMARK 465     LYS P   171                                                      
REMARK 465     ARG P   172                                                      
REMARK 465     ARG P   173                                                      
REMARK 465     LYS P   174                                                      
REMARK 465     LEU P   175                                                      
REMARK 465     LYS P   176                                                      
REMARK 465     ASN P   177                                                      
REMARK 465     LYS P   178                                                      
REMARK 465     ARG P   179                                                      
REMARK 465     ARG P   180                                                      
REMARK 465     ARG P   181                                                      
REMARK 465     SER P   182                                                      
REMARK 465     LEU P   183                                                      
REMARK 465     PRO P   184                                                      
REMARK 465     ARG P   185                                                      
REMARK 465     PRO P   186                                                      
REMARK 465     HIS P   187                                                      
REMARK 465     ASP P   188                                                      
REMARK 465     PHE P   189                                                      
REMARK 465     PHE P   190                                                      
REMARK 465     ASP P   191                                                      
REMARK 465     ALA P   192                                                      
REMARK 465     GLN P   193                                                      
REMARK 465     THR P   194                                                      
REMARK 465     LEU P   195                                                      
REMARK 465     ASP P   196                                                      
REMARK 465     ALA P   197                                                      
REMARK 465     ILE P   198                                                      
REMARK 465     ARG P   199                                                      
REMARK 465     HIS P   200                                                      
REMARK 465     ARG P   201                                                      
REMARK 465     ALA P   202                                                      
REMARK 465     ILE P   203                                                      
REMARK 465     CYS P   204                                                      
REMARK 465     PHE P   205                                                      
REMARK 465     ASN P   206                                                      
REMARK 465     LEU P   207                                                      
REMARK 465     SER P   208                                                      
REMARK 465     ALA P   209                                                      
REMARK 465     HIS P   210                                                      
REMARK 465     ILE P   211                                                      
REMARK 465     GLU P   212                                                      
REMARK 465     SER P   213                                                      
REMARK 465     LEU P   214                                                      
REMARK 465     GLY P   215                                                      
REMARK 465     LYS P   216                                                      
REMARK 465     GLY P   217                                                      
REMARK 465     HIS P   218                                                      
REMARK 465     SER P   219                                                      
REMARK 465     VAL P   220                                                      
REMARK 465     VAL P   221                                                      
REMARK 465     PHE P   222                                                      
REMARK 465     HIS P   223                                                      
REMARK 465     SER P   224                                                      
REMARK 465     THR P   225                                                      
REMARK 465     VAL P   226                                                      
REMARK 465     ILE P   227                                                      
REMARK 465     ALA P   228                                                      
REMARK 465     LYS P   229                                                      
REMARK 465     ARG P   230                                                      
REMARK 465     LYS P   231                                                      
REMARK 465     MET Q     1                                                      
REMARK 465     ALA Q     2                                                      
REMARK 465     PRO Q     3                                                      
REMARK 465     GLN Q     4                                                      
REMARK 465     LYS Q     5                                                      
REMARK 465     HIS Q     6                                                      
REMARK 465     GLY Q     7                                                      
REMARK 465     GLY Q     8                                                      
REMARK 465     GLY Q     9                                                      
REMARK 465     GLY Q    10                                                      
REMARK 465     GLY Q    11                                                      
REMARK 465     GLY Q    12                                                      
REMARK 465     GLY Q    13                                                      
REMARK 465     SER Q    14                                                      
REMARK 465     GLY Q    15                                                      
REMARK 465     PRO Q    16                                                      
REMARK 465     SER Q    17                                                      
REMARK 465     ALA Q    18                                                      
REMARK 465     GLY Q    19                                                      
REMARK 465     SER Q    20                                                      
REMARK 465     GLY Q    21                                                      
REMARK 465     GLY Q    22                                                      
REMARK 465     GLY Q    23                                                      
REMARK 465     GLY Q    24                                                      
REMARK 465     PHE Q    25                                                      
REMARK 465     GLY Q    26                                                      
REMARK 465     GLY Q    27                                                      
REMARK 465     SER Q    28                                                      
REMARK 465     ALA Q    29                                                      
REMARK 465     ALA Q    30                                                      
REMARK 465     VAL Q    31                                                      
REMARK 465     ALA Q    32                                                      
REMARK 465     ALA Q    33                                                      
REMARK 465     ALA Q    34                                                      
REMARK 465     THR Q    35                                                      
REMARK 465     ALA Q    36                                                      
REMARK 465     SER Q    37                                                      
REMARK 465     GLY Q    38                                                      
REMARK 465     GLY Q    39                                                      
REMARK 465     LYS Q    40                                                      
REMARK 465     SER Q    41                                                      
REMARK 465     GLY Q    42                                                      
REMARK 465     GLY Q    43                                                      
REMARK 465     GLY Q    44                                                      
REMARK 465     SER Q    45                                                      
REMARK 465     CYS Q    46                                                      
REMARK 465     GLY Q    47                                                      
REMARK 465     GLY Q    48                                                      
REMARK 465     GLY Q    49                                                      
REMARK 465     GLY Q    50                                                      
REMARK 465     SER Q    51                                                      
REMARK 465     TYR Q    52                                                      
REMARK 465     SER Q    53                                                      
REMARK 465     ALA Q    54                                                      
REMARK 465     SER Q    55                                                      
REMARK 465     SER Q    56                                                      
REMARK 465     SER Q    57                                                      
REMARK 465     SER Q    58                                                      
REMARK 465     SER Q    59                                                      
REMARK 465     ALA Q    60                                                      
REMARK 465     ALA Q    61                                                      
REMARK 465     ALA Q    62                                                      
REMARK 465     ALA Q    63                                                      
REMARK 465     ALA Q    64                                                      
REMARK 465     GLY Q    65                                                      
REMARK 465     ALA Q    66                                                      
REMARK 465     ALA Q    67                                                      
REMARK 465     VAL Q    68                                                      
REMARK 465     LEU Q    69                                                      
REMARK 465     PRO Q    70                                                      
REMARK 465     VAL Q    71                                                      
REMARK 465     LYS Q    72                                                      
REMARK 465     LYS Q    73                                                      
REMARK 465     PRO Q    74                                                      
REMARK 465     LYS Q    75                                                      
REMARK 465     MET Q    76                                                      
REMARK 465     GLU Q    77                                                      
REMARK 465     HIS Q    78                                                      
REMARK 465     VAL Q    79                                                      
REMARK 465     GLN Q    80                                                      
REMARK 465     GLU Q   147                                                      
REMARK 465     GLN Q   148                                                      
REMARK 465     GLU Q   149                                                      
REMARK 465     SER Q   150                                                      
REMARK 465     HIS Q   151                                                      
REMARK 465     SER Q   152                                                      
REMARK 465     LEU Q   153                                                      
REMARK 465     SER Q   154                                                      
REMARK 465     ALA Q   155                                                      
REMARK 465     HIS Q   156                                                      
REMARK 465     LEU Q   157                                                      
REMARK 465     GLN Q   158                                                      
REMARK 465     LEU Q   159                                                      
REMARK 465     THR Q   160                                                      
REMARK 465     PHE Q   161                                                      
REMARK 465     THR Q   162                                                      
REMARK 465     GLY Q   163                                                      
REMARK 465     PHE Q   164                                                      
REMARK 465     PHE Q   165                                                      
REMARK 465     HIS Q   166                                                      
REMARK 465     LYS Q   167                                                      
REMARK 465     ASN Q   168                                                      
REMARK 465     ASP Q   169                                                      
REMARK 465     LYS Q   170                                                      
REMARK 465     PRO Q   171                                                      
REMARK 465     SER Q   172                                                      
REMARK 465     PRO Q   173                                                      
REMARK 465     ASN Q   174                                                      
REMARK 465     SER Q   175                                                      
REMARK 465     GLU Q   176                                                      
REMARK 465     ASN Q   177                                                      
REMARK 465     GLU Q   178                                                      
REMARK 465     GLN Q   179                                                      
REMARK 465     ASN Q   180                                                      
REMARK 465     SER Q   181                                                      
REMARK 465     VAL Q   182                                                      
REMARK 465     THR Q   183                                                      
REMARK 465     LEU Q   184                                                      
REMARK 465     GLU Q   185                                                      
REMARK 465     VAL Q   186                                                      
REMARK 465     LEU Q   187                                                      
REMARK 465     LEU Q   188                                                      
REMARK 465     VAL Q   189                                                      
REMARK 465     LYS Q   190                                                      
REMARK 465     VAL Q   191                                                      
REMARK 465     CYS Q   192                                                      
REMARK 465     HIS Q   193                                                      
REMARK 465     LYS Q   194                                                      
REMARK 465     LYS Q   195                                                      
REMARK 465     ARG Q   196                                                      
REMARK 465     LYS Q   197                                                      
REMARK 465     ASP Q   198                                                      
REMARK 465     VAL Q   199                                                      
REMARK 465     SER Q   200                                                      
REMARK 465     CYS Q   201                                                      
REMARK 465     PRO Q   202                                                      
REMARK 465     ILE Q   203                                                      
REMARK 465     ARG Q   204                                                      
REMARK 465     GLN Q   205                                                      
REMARK 465     VAL Q   206                                                      
REMARK 465     PRO Q   207                                                      
REMARK 465     THR Q   208                                                      
REMARK 465     GLY Q   209                                                      
REMARK 465     LYS Q   210                                                      
REMARK 465     LYS Q   211                                                      
REMARK 465     GLN Q   212                                                      
REMARK 465     VAL Q   213                                                      
REMARK 465     PRO Q   214                                                      
REMARK 465     LEU Q   215                                                      
REMARK 465     ASN Q   216                                                      
REMARK 465     PRO Q   217                                                      
REMARK 465     ASP Q   218                                                      
REMARK 465     LEU Q   219                                                      
REMARK 465     ASN Q   220                                                      
REMARK 465     GLN Q   221                                                      
REMARK 465     THR Q   222                                                      
REMARK 465     LYS Q   223                                                      
REMARK 465     PRO Q   224                                                      
REMARK 465     GLY Q   225                                                      
REMARK 465     ASN Q   226                                                      
REMARK 465     PHE Q   227                                                      
REMARK 465     PRO Q   228                                                      
REMARK 465     SER Q   229                                                      
REMARK 465     LEU Q   230                                                      
REMARK 465     ALA Q   231                                                      
REMARK 465     VAL Q   232                                                      
REMARK 465     SER Q   233                                                      
REMARK 465     SER Q   234                                                      
REMARK 465     ASN Q   235                                                      
REMARK 465     GLU Q   236                                                      
REMARK 465     PHE Q   237                                                      
REMARK 465     GLU Q   238                                                      
REMARK 465     PRO Q   239                                                      
REMARK 465     SER Q   240                                                      
REMARK 465     ASN Q   241                                                      
REMARK 465     SER Q   242                                                      
REMARK 465     HIS Q   243                                                      
REMARK 465     MET Q   244                                                      
REMARK 465     VAL Q   245                                                      
REMARK 465     LYS Q   246                                                      
REMARK 465     SER Q   247                                                      
REMARK 465     TYR Q   248                                                      
REMARK 465     SER Q   249                                                      
REMARK 465     LEU Q   250                                                      
REMARK 465     LEU Q   251                                                      
REMARK 465     PHE Q   252                                                      
REMARK 465     ARG Q   253                                                      
REMARK 465     VAL Q   254                                                      
REMARK 465     THR Q   255                                                      
REMARK 465     ARG Q   256                                                      
REMARK 465     PRO Q   257                                                      
REMARK 465     GLY Q   258                                                      
REMARK 465     ARG Q   259                                                      
REMARK 465     ARG Q   260                                                      
REMARK 465     GLU Q   261                                                      
REMARK 465     PHE Q   262                                                      
REMARK 465     ASN Q   263                                                      
REMARK 465     GLY Q   264                                                      
REMARK 465     MET Q   265                                                      
REMARK 465     ILE Q   266                                                      
REMARK 465     ASN Q   267                                                      
REMARK 465     GLY Q   268                                                      
REMARK 465     GLU Q   269                                                      
REMARK 465     THR Q   270                                                      
REMARK 465     ASN Q   271                                                      
REMARK 465     GLU Q   272                                                      
REMARK 465     ASN Q   273                                                      
REMARK 465     ILE Q   274                                                      
REMARK 465     ASP Q   275                                                      
REMARK 465     VAL Q   276                                                      
REMARK 465     ASN Q   277                                                      
REMARK 465     GLU Q   278                                                      
REMARK 465     GLU Q   279                                                      
REMARK 465     LEU Q   280                                                      
REMARK 465     PRO Q   281                                                      
REMARK 465     ALA Q   282                                                      
REMARK 465     ARG Q   283                                                      
REMARK 465     ARG Q   284                                                      
REMARK 465     LYS Q   285                                                      
REMARK 465     ARG Q   286                                                      
REMARK 465     ASN Q   287                                                      
REMARK 465     ARG Q   288                                                      
REMARK 465     GLU Q   289                                                      
REMARK 465     ASP Q   290                                                      
REMARK 465     GLY Q   291                                                      
REMARK 465     GLU Q   292                                                      
REMARK 465     LYS Q   293                                                      
REMARK 465     THR Q   294                                                      
REMARK 465     PHE Q   295                                                      
REMARK 465     VAL Q   296                                                      
REMARK 465     ALA Q   297                                                      
REMARK 465     GLN Q   298                                                      
REMARK 465     MET Q   299                                                      
REMARK 465     THR Q   300                                                      
REMARK 465     VAL Q   301                                                      
REMARK 465     PHE Q   302                                                      
REMARK 465     ASP Q   303                                                      
REMARK 465     LYS Q   304                                                      
REMARK 465     ASN Q   305                                                      
REMARK 465     ARG Q   306                                                      
REMARK 465     ARG Q   307                                                      
REMARK 465     LEU Q   308                                                      
REMARK 465     GLN Q   309                                                      
REMARK 465     LEU Q   310                                                      
REMARK 465     LEU Q   311                                                      
REMARK 465     ASP Q   312                                                      
REMARK 465     GLY Q   313                                                      
REMARK 465     GLU Q   314                                                      
REMARK 465     TYR Q   315                                                      
REMARK 465     GLU Q   316                                                      
REMARK 465     VAL Q   317                                                      
REMARK 465     ALA Q   318                                                      
REMARK 465     MET Q   319                                                      
REMARK 465     GLN Q   320                                                      
REMARK 465     GLU Q   321                                                      
REMARK 465     MET Q   322                                                      
REMARK 465     GLU Q   323                                                      
REMARK 465     GLU Q   324                                                      
REMARK 465     CYS Q   325                                                      
REMARK 465     PRO Q   326                                                      
REMARK 465     ILE Q   327                                                      
REMARK 465     SER Q   328                                                      
REMARK 465     LYS Q   329                                                      
REMARK 465     LYS Q   330                                                      
REMARK 465     ARG Q   331                                                      
REMARK 465     ALA Q   332                                                      
REMARK 465     THR Q   333                                                      
REMARK 465     TRP Q   334                                                      
REMARK 465     GLU Q   335                                                      
REMARK 465     THR Q   336                                                      
REMARK 465     ILE Q   337                                                      
REMARK 465     LEU Q   338                                                      
REMARK 465     ASP Q   339                                                      
REMARK 465     GLY Q   340                                                      
REMARK 465     LYS Q   341                                                      
REMARK 465     ARG Q   342                                                      
REMARK 465     LEU Q   343                                                      
REMARK 465     PRO Q   344                                                      
REMARK 465     PRO Q   345                                                      
REMARK 465     PHE Q   346                                                      
REMARK 465     GLU Q   347                                                      
REMARK 465     THR Q   348                                                      
REMARK 465     PHE Q   349                                                      
REMARK 465     SER Q   350                                                      
REMARK 465     GLN Q   351                                                      
REMARK 465     GLY Q   352                                                      
REMARK 465     PRO Q   353                                                      
REMARK 465     THR Q   354                                                      
REMARK 465     LEU Q   355                                                      
REMARK 465     GLN Q   356                                                      
REMARK 465     PHE Q   357                                                      
REMARK 465     THR Q   358                                                      
REMARK 465     LEU Q   359                                                      
REMARK 465     ARG Q   360                                                      
REMARK 465     TRP Q   361                                                      
REMARK 465     THR Q   362                                                      
REMARK 465     GLY Q   363                                                      
REMARK 465     GLU Q   364                                                      
REMARK 465     THR Q   365                                                      
REMARK 465     ASN Q   366                                                      
REMARK 465     ASP Q   367                                                      
REMARK 465     LYS Q   368                                                      
REMARK 465     SER Q   369                                                      
REMARK 465     THR Q   370                                                      
REMARK 465     ALA Q   371                                                      
REMARK 465     PRO Q   372                                                      
REMARK 465     ILE Q   373                                                      
REMARK 465     ALA Q   374                                                      
REMARK 465     LYS Q   375                                                      
REMARK 465     PRO Q   376                                                      
REMARK 465     LEU Q   377                                                      
REMARK 465     ALA Q   378                                                      
REMARK 465     THR Q   379                                                      
REMARK 465     ARG Q   380                                                      
REMARK 465     ASN Q   381                                                      
REMARK 465     SER Q   382                                                      
REMARK 465     GLU Q   383                                                      
REMARK 465     SER Q   384                                                      
REMARK 465     LEU Q   385                                                      
REMARK 465     HIS Q   386                                                      
REMARK 465     GLN Q   387                                                      
REMARK 465     GLU Q   388                                                      
REMARK 465     ASN Q   389                                                      
REMARK 465     LYS Q   390                                                      
REMARK 465     PRO Q   391                                                      
REMARK 465     GLY Q   392                                                      
REMARK 465     SER Q   393                                                      
REMARK 465     VAL Q   394                                                      
REMARK 465     LYS Q   395                                                      
REMARK 465     PRO Q   396                                                      
REMARK 465     THR Q   397                                                      
REMARK 465     GLN Q   398                                                      
REMARK 465     THR Q   399                                                      
REMARK 465     ILE Q   400                                                      
REMARK 465     ALA Q   401                                                      
REMARK 465     VAL Q   402                                                      
REMARK 465     LYS Q   403                                                      
REMARK 465     GLU Q   404                                                      
REMARK 465     SER Q   405                                                      
REMARK 465     LEU Q   406                                                      
REMARK 465     THR Q   407                                                      
REMARK 465     THR Q   408                                                      
REMARK 465     ASP Q   409                                                      
REMARK 465     LEU Q   410                                                      
REMARK 465     GLN Q   411                                                      
REMARK 465     THR Q   412                                                      
REMARK 465     ARG Q   413                                                      
REMARK 465     LYS Q   414                                                      
REMARK 465     GLU Q   415                                                      
REMARK 465     LYS Q   416                                                      
REMARK 465     ASP Q   417                                                      
REMARK 465     THR Q   418                                                      
REMARK 465     PRO Q   419                                                      
REMARK 465     ASN Q   420                                                      
REMARK 465     GLU Q   421                                                      
REMARK 465     ASN Q   422                                                      
REMARK 465     ARG Q   423                                                      
REMARK 465     GLN Q   424                                                      
REMARK 465     LYS Q   425                                                      
REMARK 465     LEU Q   426                                                      
REMARK 465     ARG Q   427                                                      
REMARK 465     ILE Q   428                                                      
REMARK 465     PHE Q   429                                                      
REMARK 465     TYR Q   430                                                      
REMARK 465     GLN Q   431                                                      
REMARK 465     PHE Q   432                                                      
REMARK 465     LEU Q   433                                                      
REMARK 465     TYR Q   434                                                      
REMARK 465     ASN Q   435                                                      
REMARK 465     ASN Q   436                                                      
REMARK 465     ASN Q   437                                                      
REMARK 465     THR Q   438                                                      
REMARK 465     ARG Q   439                                                      
REMARK 465     GLN Q   440                                                      
REMARK 465     GLN Q   441                                                      
REMARK 465     THR Q   442                                                      
REMARK 465     GLU Q   443                                                      
REMARK 465     ALA Q   444                                                      
REMARK 465     ARG Q   445                                                      
REMARK 465     ASP Q   446                                                      
REMARK 465     ASP Q   447                                                      
REMARK 465     LEU Q   448                                                      
REMARK 465     HIS Q   449                                                      
REMARK 465     CYS Q   450                                                      
REMARK 465     PRO Q   451                                                      
REMARK 465     TRP Q   452                                                      
REMARK 465     CYS Q   453                                                      
REMARK 465     THR Q   454                                                      
REMARK 465     LEU Q   455                                                      
REMARK 465     ASN Q   456                                                      
REMARK 465     CYS Q   457                                                      
REMARK 465     ARG Q   458                                                      
REMARK 465     LYS Q   459                                                      
REMARK 465     LEU Q   460                                                      
REMARK 465     TYR Q   461                                                      
REMARK 465     SER Q   462                                                      
REMARK 465     LEU Q   463                                                      
REMARK 465     LEU Q   464                                                      
REMARK 465     LYS Q   465                                                      
REMARK 465     HIS Q   466                                                      
REMARK 465     LEU Q   467                                                      
REMARK 465     LYS Q   468                                                      
REMARK 465     LEU Q   469                                                      
REMARK 465     CYS Q   470                                                      
REMARK 465     HIS Q   471                                                      
REMARK 465     SER Q   472                                                      
REMARK 465     ARG Q   473                                                      
REMARK 465     PHE Q   474                                                      
REMARK 465     ILE Q   475                                                      
REMARK 465     PHE Q   476                                                      
REMARK 465     ASN Q   477                                                      
REMARK 465     TYR Q   478                                                      
REMARK 465     VAL Q   479                                                      
REMARK 465     TYR Q   480                                                      
REMARK 465     HIS Q   481                                                      
REMARK 465     PRO Q   482                                                      
REMARK 465     LYS Q   483                                                      
REMARK 465     GLY Q   484                                                      
REMARK 465     ALA Q   485                                                      
REMARK 465     ARG Q   486                                                      
REMARK 465     ILE Q   487                                                      
REMARK 465     ASP Q   488                                                      
REMARK 465     VAL Q   489                                                      
REMARK 465     SER Q   490                                                      
REMARK 465     ILE Q   491                                                      
REMARK 465     ASN Q   492                                                      
REMARK 465     GLU Q   493                                                      
REMARK 465     CYS Q   494                                                      
REMARK 465     TYR Q   495                                                      
REMARK 465     ASP Q   496                                                      
REMARK 465     GLY Q   497                                                      
REMARK 465     SER Q   498                                                      
REMARK 465     TYR Q   499                                                      
REMARK 465     ALA Q   500                                                      
REMARK 465     GLY Q   501                                                      
REMARK 465     ASN Q   502                                                      
REMARK 465     PRO Q   503                                                      
REMARK 465     GLN Q   504                                                      
REMARK 465     ASP Q   505                                                      
REMARK 465     ILE Q   506                                                      
REMARK 465     HIS Q   507                                                      
REMARK 465     ARG Q   508                                                      
REMARK 465     GLN Q   509                                                      
REMARK 465     PRO Q   510                                                      
REMARK 465     GLY Q   511                                                      
REMARK 465     PHE Q   512                                                      
REMARK 465     ALA Q   513                                                      
REMARK 465     PHE Q   514                                                      
REMARK 465     SER Q   515                                                      
REMARK 465     ARG Q   516                                                      
REMARK 465     ASN Q   517                                                      
REMARK 465     GLY Q   518                                                      
REMARK 465     PRO Q   519                                                      
REMARK 465     VAL Q   520                                                      
REMARK 465     LYS Q   521                                                      
REMARK 465     ARG Q   522                                                      
REMARK 465     THR Q   523                                                      
REMARK 465     PRO Q   524                                                      
REMARK 465     ILE Q   525                                                      
REMARK 465     THR Q   526                                                      
REMARK 465     HIS Q   527                                                      
REMARK 465     ILE Q   528                                                      
REMARK 465     LEU Q   529                                                      
REMARK 465     VAL Q   530                                                      
REMARK 465     CYS Q   531                                                      
REMARK 465     ARG Q   532                                                      
REMARK 465     PRO Q   533                                                      
REMARK 465     LYS Q   534                                                      
REMARK 465     ARG Q   535                                                      
REMARK 465     THR Q   536                                                      
REMARK 465     LYS Q   537                                                      
REMARK 465     ALA Q   538                                                      
REMARK 465     SER Q   539                                                      
REMARK 465     MET Q   540                                                      
REMARK 465     SER Q   541                                                      
REMARK 465     GLU Q   542                                                      
REMARK 465     PHE Q   543                                                      
REMARK 465     LEU Q   544                                                      
REMARK 465     GLU Q   545                                                      
REMARK 465     SER Q   546                                                      
REMARK 465     GLU Q   547                                                      
REMARK 465     ASP Q   548                                                      
REMARK 465     GLY Q   549                                                      
REMARK 465     GLU Q   550                                                      
REMARK 465     VAL Q   551                                                      
REMARK 465     GLU Q   552                                                      
REMARK 465     GLN Q   553                                                      
REMARK 465     GLN Q   554                                                      
REMARK 465     ARG Q   555                                                      
REMARK 465     THR Q   556                                                      
REMARK 465     TYR Q   557                                                      
REMARK 465     SER Q   558                                                      
REMARK 465     SER Q   559                                                      
REMARK 465     GLY Q   560                                                      
REMARK 465     HIS Q   561                                                      
REMARK 465     ASN Q   562                                                      
REMARK 465     ARG Q   563                                                      
REMARK 465     LEU Q   564                                                      
REMARK 465     TYR Q   565                                                      
REMARK 465     PHE Q   566                                                      
REMARK 465     HIS Q   567                                                      
REMARK 465     SER Q   568                                                      
REMARK 465     ASP Q   569                                                      
REMARK 465     THR Q   570                                                      
REMARK 465     CYS Q   571                                                      
REMARK 465     LEU Q   572                                                      
REMARK 465     PRO Q   573                                                      
REMARK 465     LEU Q   574                                                      
REMARK 465     ARG Q   575                                                      
REMARK 465     PRO Q   576                                                      
REMARK 465     GLN Q   577                                                      
REMARK 465     GLU Q   578                                                      
REMARK 465     MET Q   579                                                      
REMARK 465     GLU Q   580                                                      
REMARK 465     VAL Q   581                                                      
REMARK 465     ASP Q   582                                                      
REMARK 465     SER Q   583                                                      
REMARK 465     GLU Q   584                                                      
REMARK 465     ASP Q   585                                                      
REMARK 465     GLU Q   586                                                      
REMARK 465     LYS Q   587                                                      
REMARK 465     ASP Q   588                                                      
REMARK 465     PRO Q   589                                                      
REMARK 465     GLU Q   590                                                      
REMARK 465     TRP Q   591                                                      
REMARK 465     LEU Q   592                                                      
REMARK 465     ARG Q   593                                                      
REMARK 465     GLU Q   594                                                      
REMARK 465     LYS Q   595                                                      
REMARK 465     THR Q   596                                                      
REMARK 465     ILE Q   597                                                      
REMARK 465     THR Q   598                                                      
REMARK 465     GLN Q   599                                                      
REMARK 465     ILE Q   600                                                      
REMARK 465     GLU Q   601                                                      
REMARK 465     GLU Q   602                                                      
REMARK 465     PHE Q   603                                                      
REMARK 465     SER Q   604                                                      
REMARK 465     ASP Q   605                                                      
REMARK 465     VAL Q   606                                                      
REMARK 465     ASN Q   607                                                      
REMARK 465     GLU Q   608                                                      
REMARK 465     GLY Q   609                                                      
REMARK 465     GLU Q   610                                                      
REMARK 465     LYS Q   611                                                      
REMARK 465     GLU Q   612                                                      
REMARK 465     VAL Q   613                                                      
REMARK 465     MET Q   614                                                      
REMARK 465     LYS Q   615                                                      
REMARK 465     LEU Q   616                                                      
REMARK 465     TRP Q   617                                                      
REMARK 465     ASN Q   618                                                      
REMARK 465     LEU Q   619                                                      
REMARK 465     HIS Q   620                                                      
REMARK 465     VAL Q   621                                                      
REMARK 465     MET Q   622                                                      
REMARK 465     LYS Q   623                                                      
REMARK 465     HIS Q   624                                                      
REMARK 465     GLY Q   625                                                      
REMARK 465     PHE Q   626                                                      
REMARK 465     ILE Q   627                                                      
REMARK 465     ALA Q   628                                                      
REMARK 465     ASP Q   629                                                      
REMARK 465     ASN Q   630                                                      
REMARK 465     GLN Q   631                                                      
REMARK 465     MET Q   632                                                      
REMARK 465     ASN Q   633                                                      
REMARK 465     HIS Q   634                                                      
REMARK 465     ALA Q   635                                                      
REMARK 465     CYS Q   636                                                      
REMARK 465     MET Q   637                                                      
REMARK 465     LEU Q   638                                                      
REMARK 465     PHE Q   639                                                      
REMARK 465     VAL Q   640                                                      
REMARK 465     GLU Q   641                                                      
REMARK 465     ASN Q   642                                                      
REMARK 465     TYR Q   643                                                      
REMARK 465     GLY Q   644                                                      
REMARK 465     GLN Q   645                                                      
REMARK 465     LYS Q   646                                                      
REMARK 465     ILE Q   647                                                      
REMARK 465     ILE Q   648                                                      
REMARK 465     LYS Q   649                                                      
REMARK 465     LYS Q   650                                                      
REMARK 465     ASN Q   651                                                      
REMARK 465     LEU Q   652                                                      
REMARK 465     CYS Q   653                                                      
REMARK 465     ARG Q   654                                                      
REMARK 465     ASN Q   655                                                      
REMARK 465     PHE Q   656                                                      
REMARK 465     MET Q   657                                                      
REMARK 465     LEU Q   658                                                      
REMARK 465     HIS Q   659                                                      
REMARK 465     LEU Q   660                                                      
REMARK 465     VAL Q   661                                                      
REMARK 465     SER Q   662                                                      
REMARK 465     MET Q   663                                                      
REMARK 465     HIS Q   664                                                      
REMARK 465     ASP Q   665                                                      
REMARK 465     PHE Q   666                                                      
REMARK 465     ASN Q   667                                                      
REMARK 465     LEU Q   668                                                      
REMARK 465     ILE Q   669                                                      
REMARK 465     SER Q   670                                                      
REMARK 465     ILE Q   671                                                      
REMARK 465     MET Q   672                                                      
REMARK 465     SER Q   673                                                      
REMARK 465     ILE Q   674                                                      
REMARK 465     ASP Q   675                                                      
REMARK 465     LYS Q   676                                                      
REMARK 465     ALA Q   677                                                      
REMARK 465     VAL Q   678                                                      
REMARK 465     THR Q   679                                                      
REMARK 465     LYS Q   680                                                      
REMARK 465     LEU Q   681                                                      
REMARK 465     ARG Q   682                                                      
REMARK 465     GLU Q   683                                                      
REMARK 465     MET Q   684                                                      
REMARK 465     GLN Q   685                                                      
REMARK 465     GLN Q   686                                                      
REMARK 465     LYS Q   687                                                      
REMARK 465     LEU Q   688                                                      
REMARK 465     GLU Q   689                                                      
REMARK 465     LYS Q   690                                                      
REMARK 465     GLY Q   691                                                      
REMARK 465     GLU Q   692                                                      
REMARK 465     SER Q   693                                                      
REMARK 465     ALA Q   694                                                      
REMARK 465     SER Q   695                                                      
REMARK 465     PRO Q   696                                                      
REMARK 465     ALA Q   697                                                      
REMARK 465     ASN Q   698                                                      
REMARK 465     GLU Q   699                                                      
REMARK 465     GLU Q   700                                                      
REMARK 465     ILE Q   701                                                      
REMARK 465     THR Q   702                                                      
REMARK 465     GLU Q   703                                                      
REMARK 465     GLU Q   704                                                      
REMARK 465     GLN Q   705                                                      
REMARK 465     ASN Q   706                                                      
REMARK 465     GLY Q   707                                                      
REMARK 465     THR Q   708                                                      
REMARK 465     ALA Q   709                                                      
REMARK 465     ASN Q   710                                                      
REMARK 465     GLY Q   711                                                      
REMARK 465     PHE Q   712                                                      
REMARK 465     SER Q   713                                                      
REMARK 465     GLU Q   714                                                      
REMARK 465     ILE Q   715                                                      
REMARK 465     ASN Q   716                                                      
REMARK 465     SER Q   717                                                      
REMARK 465     LYS Q   718                                                      
REMARK 465     GLU Q   719                                                      
REMARK 465     LYS Q   720                                                      
REMARK 465     ALA Q   721                                                      
REMARK 465     LEU Q   722                                                      
REMARK 465     GLU Q   723                                                      
REMARK 465     THR Q   724                                                      
REMARK 465     ASP Q   725                                                      
REMARK 465     SER Q   726                                                      
REMARK 465     VAL Q   727                                                      
REMARK 465     SER Q   728                                                      
REMARK 465     GLY Q   729                                                      
REMARK 465     VAL Q   730                                                      
REMARK 465     SER Q   731                                                      
REMARK 465     LYS Q   732                                                      
REMARK 465     GLN Q   733                                                      
REMARK 465     SER Q   734                                                      
REMARK 465     LYS Q   735                                                      
REMARK 465     LYS Q   736                                                      
REMARK 465     GLN Q   737                                                      
REMARK 465     LYS Q   738                                                      
REMARK 465     LEU Q   739                                                      
REMARK 465     MET C     1                                                      
REMARK 465     GLY C     2                                                      
REMARK 465     GLN C     3                                                      
REMARK 465     THR C     4                                                      
REMARK 465     GLY C     5                                                      
REMARK 465     LYS C     6                                                      
REMARK 465     LYS C     7                                                      
REMARK 465     SER C     8                                                      
REMARK 465     GLU C     9                                                      
REMARK 465     LYS C    10                                                      
REMARK 465     GLY C    11                                                      
REMARK 465     PRO C    12                                                      
REMARK 465     VAL C    13                                                      
REMARK 465     VAL C    85                                                      
REMARK 465     THR C    86                                                      
REMARK 465     SER C    87                                                      
REMARK 465     ASP C    88                                                      
REMARK 465     LEU C    89                                                      
REMARK 465     ASP C    90                                                      
REMARK 465     PHE C    91                                                      
REMARK 465     PRO C    92                                                      
REMARK 465     THR C    93                                                      
REMARK 465     GLN C    94                                                      
REMARK 465     GLU C   125                                                      
REMARK 465     THR C   126                                                      
REMARK 465     VAL C   127                                                      
REMARK 465     LEU C   128                                                      
REMARK 465     HIS C   129                                                      
REMARK 465     ASN C   130                                                      
REMARK 465     ILE C   131                                                      
REMARK 465     PRO C   132                                                      
REMARK 465     TYR C   133                                                      
REMARK 465     MET C   134                                                      
REMARK 465     GLY C   135                                                      
REMARK 465     ASP C   136                                                      
REMARK 465     GLU C   137                                                      
REMARK 465     VAL C   138                                                      
REMARK 465     LEU C   139                                                      
REMARK 465     ASP C   140                                                      
REMARK 465     GLN C   141                                                      
REMARK 465     ASP C   142                                                      
REMARK 465     GLY C   143                                                      
REMARK 465     THR C   144                                                      
REMARK 465     PHE C   145                                                      
REMARK 465     ILE C   146                                                      
REMARK 465     GLU C   147                                                      
REMARK 465     GLU C   148                                                      
REMARK 465     LEU C   149                                                      
REMARK 465     ILE C   150                                                      
REMARK 465     LYS C   151                                                      
REMARK 465     ASN C   152                                                      
REMARK 465     TYR C   153                                                      
REMARK 465     ASP C   154                                                      
REMARK 465     GLY C   155                                                      
REMARK 465     LYS C   156                                                      
REMARK 465     VAL C   157                                                      
REMARK 465     HIS C   158                                                      
REMARK 465     GLY C   159                                                      
REMARK 465     ASP C   160                                                      
REMARK 465     ARG C   161                                                      
REMARK 465     GLU C   162                                                      
REMARK 465     CYS C   163                                                      
REMARK 465     ASN C   182                                                      
REMARK 465     ASP C   183                                                      
REMARK 465     ASP C   184                                                      
REMARK 465     ASP C   185                                                      
REMARK 465     ASP C   186                                                      
REMARK 465     ASP C   187                                                      
REMARK 465     ASP C   188                                                      
REMARK 465     ASP C   189                                                      
REMARK 465     GLY C   190                                                      
REMARK 465     ASP C   191                                                      
REMARK 465     ASP C   192                                                      
REMARK 465     PRO C   193                                                      
REMARK 465     GLU C   194                                                      
REMARK 465     GLU C   195                                                      
REMARK 465     ARG C   196                                                      
REMARK 465     GLU C   197                                                      
REMARK 465     GLU C   198                                                      
REMARK 465     LYS C   199                                                      
REMARK 465     GLN C   200                                                      
REMARK 465     LYS C   201                                                      
REMARK 465     ASP C   202                                                      
REMARK 465     LEU C   203                                                      
REMARK 465     GLU C   204                                                      
REMARK 465     ASP C   205                                                      
REMARK 465     HIS C   206                                                      
REMARK 465     ARG C   207                                                      
REMARK 465     ASP C   208                                                      
REMARK 465     ASP C   209                                                      
REMARK 465     LYS C   210                                                      
REMARK 465     GLU C   211                                                      
REMARK 465     SER C   212                                                      
REMARK 465     ARG C   213                                                      
REMARK 465     PRO C   214                                                      
REMARK 465     PRO C   215                                                      
REMARK 465     ARG C   216                                                      
REMARK 465     LYS C   217                                                      
REMARK 465     PHE C   218                                                      
REMARK 465     THR C   248                                                      
REMARK 465     GLU C   249                                                      
REMARK 465     GLN C   250                                                      
REMARK 465     GLN C   251                                                      
REMARK 465     LEU C   252                                                      
REMARK 465     PRO C   253                                                      
REMARK 465     GLY C   254                                                      
REMARK 465     ALA C   255                                                      
REMARK 465     LEU C   256                                                      
REMARK 465     PRO C   257                                                      
REMARK 465     PRO C   258                                                      
REMARK 465     GLU C   259                                                      
REMARK 465     CYS C   260                                                      
REMARK 465     THR C   261                                                      
REMARK 465     PRO C   262                                                      
REMARK 465     ASN C   263                                                      
REMARK 465     ILE C   264                                                      
REMARK 465     ASP C   265                                                      
REMARK 465     GLY C   266                                                      
REMARK 465     PRO C   267                                                      
REMARK 465     ASN C   268                                                      
REMARK 465     ALA C   269                                                      
REMARK 465     LYS C   270                                                      
REMARK 465     SER C   271                                                      
REMARK 465     VAL C   272                                                      
REMARK 465     GLN C   273                                                      
REMARK 465     ARG C   274                                                      
REMARK 465     GLU C   275                                                      
REMARK 465     GLN C   276                                                      
REMARK 465     SER C   277                                                      
REMARK 465     LEU C   278                                                      
REMARK 465     HIS C   279                                                      
REMARK 465     SER C   280                                                      
REMARK 465     PHE C   281                                                      
REMARK 465     HIS C   282                                                      
REMARK 465     THR C   283                                                      
REMARK 465     LEU C   284                                                      
REMARK 465     PHE C   285                                                      
REMARK 465     CYS C   286                                                      
REMARK 465     ARG C   287                                                      
REMARK 465     ARG C   288                                                      
REMARK 465     CYS C   289                                                      
REMARK 465     PHE C   290                                                      
REMARK 465     LYS C   291                                                      
REMARK 465     TYR C   292                                                      
REMARK 465     ASP C   293                                                      
REMARK 465     CYS C   294                                                      
REMARK 465     PHE C   295                                                      
REMARK 465     LEU C   296                                                      
REMARK 465     HIS C   297                                                      
REMARK 465     PRO C   298                                                      
REMARK 465     PHE C   299                                                      
REMARK 465     HIS C   300                                                      
REMARK 465     ALA C   301                                                      
REMARK 465     THR C   302                                                      
REMARK 465     PRO C   303                                                      
REMARK 465     ASN C   304                                                      
REMARK 465     THR C   305                                                      
REMARK 465     TYR C   306                                                      
REMARK 465     LYS C   307                                                      
REMARK 465     ARG C   308                                                      
REMARK 465     LYS C   309                                                      
REMARK 465     ASN C   310                                                      
REMARK 465     THR C   311                                                      
REMARK 465     GLU C   312                                                      
REMARK 465     THR C   313                                                      
REMARK 465     ALA C   314                                                      
REMARK 465     LEU C   315                                                      
REMARK 465     ASP C   316                                                      
REMARK 465     ASN C   317                                                      
REMARK 465     LYS C   318                                                      
REMARK 465     PRO C   319                                                      
REMARK 465     CYS C   320                                                      
REMARK 465     GLY C   321                                                      
REMARK 465     PRO C   322                                                      
REMARK 465     GLN C   323                                                      
REMARK 465     CYS C   324                                                      
REMARK 465     TYR C   325                                                      
REMARK 465     GLN C   326                                                      
REMARK 465     HIS C   327                                                      
REMARK 465     LEU C   328                                                      
REMARK 465     GLU C   329                                                      
REMARK 465     GLY C   330                                                      
REMARK 465     ALA C   331                                                      
REMARK 465     LYS C   332                                                      
REMARK 465     GLU C   333                                                      
REMARK 465     PHE C   334                                                      
REMARK 465     ALA C   335                                                      
REMARK 465     ALA C   336                                                      
REMARK 465     ALA C   337                                                      
REMARK 465     LEU C   338                                                      
REMARK 465     THR C   339                                                      
REMARK 465     ALA C   340                                                      
REMARK 465     GLU C   341                                                      
REMARK 465     ARG C   342                                                      
REMARK 465     ILE C   343                                                      
REMARK 465     LYS C   344                                                      
REMARK 465     THR C   345                                                      
REMARK 465     PRO C   346                                                      
REMARK 465     PRO C   347                                                      
REMARK 465     LYS C   348                                                      
REMARK 465     ARG C   349                                                      
REMARK 465     PRO C   350                                                      
REMARK 465     GLY C   351                                                      
REMARK 465     GLY C   352                                                      
REMARK 465     ARG C   353                                                      
REMARK 465     ARG C   354                                                      
REMARK 465     ARG C   355                                                      
REMARK 465     GLY C   356                                                      
REMARK 465     ARG C   357                                                      
REMARK 465     LEU C   358                                                      
REMARK 465     PRO C   359                                                      
REMARK 465     ASN C   360                                                      
REMARK 465     ASN C   361                                                      
REMARK 465     SER C   362                                                      
REMARK 465     SER C   363                                                      
REMARK 465     ARG C   364                                                      
REMARK 465     PRO C   365                                                      
REMARK 465     SER C   366                                                      
REMARK 465     THR C   367                                                      
REMARK 465     PRO C   368                                                      
REMARK 465     THR C   369                                                      
REMARK 465     ILE C   370                                                      
REMARK 465     ASN C   371                                                      
REMARK 465     VAL C   372                                                      
REMARK 465     LEU C   373                                                      
REMARK 465     GLU C   374                                                      
REMARK 465     SER C   375                                                      
REMARK 465     LYS C   376                                                      
REMARK 465     ASP C   377                                                      
REMARK 465     THR C   378                                                      
REMARK 465     ASP C   379                                                      
REMARK 465     SER C   380                                                      
REMARK 465     ASP C   381                                                      
REMARK 465     ARG C   382                                                      
REMARK 465     GLU C   383                                                      
REMARK 465     ALA C   384                                                      
REMARK 465     GLY C   385                                                      
REMARK 465     THR C   386                                                      
REMARK 465     GLU C   387                                                      
REMARK 465     THR C   388                                                      
REMARK 465     GLY C   389                                                      
REMARK 465     GLY C   390                                                      
REMARK 465     GLU C   391                                                      
REMARK 465     ASN C   392                                                      
REMARK 465     ASN C   393                                                      
REMARK 465     ASP C   394                                                      
REMARK 465     LYS C   395                                                      
REMARK 465     GLU C   396                                                      
REMARK 465     GLU C   397                                                      
REMARK 465     GLU C   398                                                      
REMARK 465     GLU C   399                                                      
REMARK 465     LYS C   400                                                      
REMARK 465     LYS C   401                                                      
REMARK 465     ASP C   402                                                      
REMARK 465     GLU C   403                                                      
REMARK 465     THR C   404                                                      
REMARK 465     SER C   405                                                      
REMARK 465     SER C   406                                                      
REMARK 465     SER C   407                                                      
REMARK 465     SER C   408                                                      
REMARK 465     GLU C   409                                                      
REMARK 465     ALA C   410                                                      
REMARK 465     ASN C   411                                                      
REMARK 465     SER C   412                                                      
REMARK 465     ARG C   413                                                      
REMARK 465     CYS C   414                                                      
REMARK 465     GLN C   415                                                      
REMARK 465     THR C   416                                                      
REMARK 465     PRO C   417                                                      
REMARK 465     ILE C   418                                                      
REMARK 465     LYS C   419                                                      
REMARK 465     MET C   420                                                      
REMARK 465     LYS C   421                                                      
REMARK 465     PRO C   422                                                      
REMARK 465     ASN C   423                                                      
REMARK 465     ILE C   424                                                      
REMARK 465     GLU C   425                                                      
REMARK 465     PRO C   426                                                      
REMARK 465     PRO C   427                                                      
REMARK 465     GLU C   428                                                      
REMARK 465     ASN C   429                                                      
REMARK 465     VAL C   430                                                      
REMARK 465     GLU C   431                                                      
REMARK 465     TRP C   432                                                      
REMARK 465     SER C   433                                                      
REMARK 465     GLY C   434                                                      
REMARK 465     ALA C   435                                                      
REMARK 465     GLU C   436                                                      
REMARK 465     ALA C   437                                                      
REMARK 465     SER C   438                                                      
REMARK 465     MET C   439                                                      
REMARK 465     PHE C   440                                                      
REMARK 465     ARG C   441                                                      
REMARK 465     VAL C   442                                                      
REMARK 465     LEU C   443                                                      
REMARK 465     ILE C   444                                                      
REMARK 465     GLY C   445                                                      
REMARK 465     THR C   446                                                      
REMARK 465     TYR C   447                                                      
REMARK 465     TYR C   448                                                      
REMARK 465     ASP C   449                                                      
REMARK 465     ASN C   450                                                      
REMARK 465     PHE C   451                                                      
REMARK 465     CYS C   452                                                      
REMARK 465     ALA C   453                                                      
REMARK 465     ILE C   454                                                      
REMARK 465     ALA C   455                                                      
REMARK 465     ARG C   456                                                      
REMARK 465     LEU C   457                                                      
REMARK 465     ILE C   458                                                      
REMARK 465     GLY C   459                                                      
REMARK 465     THR C   460                                                      
REMARK 465     LYS C   461                                                      
REMARK 465     THR C   462                                                      
REMARK 465     CYS C   463                                                      
REMARK 465     ARG C   464                                                      
REMARK 465     GLN C   465                                                      
REMARK 465     VAL C   466                                                      
REMARK 465     TYR C   467                                                      
REMARK 465     GLU C   468                                                      
REMARK 465     PHE C   469                                                      
REMARK 465     ARG C   470                                                      
REMARK 465     VAL C   471                                                      
REMARK 465     LYS C   472                                                      
REMARK 465     GLU C   473                                                      
REMARK 465     SER C   474                                                      
REMARK 465     SER C   475                                                      
REMARK 465     ILE C   476                                                      
REMARK 465     ILE C   477                                                      
REMARK 465     ALA C   478                                                      
REMARK 465     PRO C   479                                                      
REMARK 465     ALA C   480                                                      
REMARK 465     PRO C   481                                                      
REMARK 465     ALA C   482                                                      
REMARK 465     GLU C   483                                                      
REMARK 465     ASP C   484                                                      
REMARK 465     VAL C   485                                                      
REMARK 465     ASP C   486                                                      
REMARK 465     THR C   487                                                      
REMARK 465     PRO C   488                                                      
REMARK 465     PRO C   489                                                      
REMARK 465     ARG C   490                                                      
REMARK 465     LYS C   491                                                      
REMARK 465     LYS C   492                                                      
REMARK 465     LYS C   493                                                      
REMARK 465     ARG C   494                                                      
REMARK 465     LYS C   495                                                      
REMARK 465     HIS C   496                                                      
REMARK 465     ARG C   497                                                      
REMARK 465     LEU C   498                                                      
REMARK 465     TRP C   499                                                      
REMARK 465     ALA C   500                                                      
REMARK 465     ALA C   501                                                      
REMARK 465     HIS C   502                                                      
REMARK 465     CYS C   503                                                      
REMARK 465     ARG C   504                                                      
REMARK 465     LYS C   505                                                      
REMARK 465     ILE C   506                                                      
REMARK 465     GLN C   507                                                      
REMARK 465     LEU C   508                                                      
REMARK 465     LYS C   509                                                      
REMARK 465     LYS C   510                                                      
REMARK 465     ASP C   511                                                      
REMARK 465     GLY C   512                                                      
REMARK 465     SER C   513                                                      
REMARK 465     SER C   514                                                      
REMARK 465     ASN C   515                                                      
REMARK 465     HIS C   516                                                      
REMARK 465     VAL C   517                                                      
REMARK 465     TYR C   518                                                      
REMARK 465     ASN C   519                                                      
REMARK 465     TYR C   520                                                      
REMARK 465     GLN C   521                                                      
REMARK 465     PRO C   522                                                      
REMARK 465     CYS C   523                                                      
REMARK 465     ASP C   524                                                      
REMARK 465     HIS C   525                                                      
REMARK 465     PRO C   526                                                      
REMARK 465     ARG C   527                                                      
REMARK 465     GLN C   528                                                      
REMARK 465     PRO C   529                                                      
REMARK 465     CYS C   530                                                      
REMARK 465     ASP C   531                                                      
REMARK 465     SER C   532                                                      
REMARK 465     SER C   533                                                      
REMARK 465     CYS C   534                                                      
REMARK 465     PRO C   535                                                      
REMARK 465     CYS C   536                                                      
REMARK 465     VAL C   537                                                      
REMARK 465     ILE C   538                                                      
REMARK 465     ALA C   539                                                      
REMARK 465     GLN C   540                                                      
REMARK 465     ASN C   541                                                      
REMARK 465     PHE C   542                                                      
REMARK 465     CYS C   543                                                      
REMARK 465     GLU C   544                                                      
REMARK 465     LYS C   545                                                      
REMARK 465     PHE C   546                                                      
REMARK 465     CYS C   547                                                      
REMARK 465     GLN C   548                                                      
REMARK 465     CYS C   549                                                      
REMARK 465     SER C   550                                                      
REMARK 465     SER C   551                                                      
REMARK 465     GLU C   552                                                      
REMARK 465     CYS C   553                                                      
REMARK 465     GLN C   554                                                      
REMARK 465     ASN C   555                                                      
REMARK 465     ARG C   556                                                      
REMARK 465     PHE C   557                                                      
REMARK 465     PRO C   558                                                      
REMARK 465     GLY C   559                                                      
REMARK 465     CYS C   560                                                      
REMARK 465     ARG C   561                                                      
REMARK 465     CYS C   562                                                      
REMARK 465     LYS C   563                                                      
REMARK 465     ALA C   564                                                      
REMARK 465     GLN C   565                                                      
REMARK 465     CYS C   566                                                      
REMARK 465     ASN C   567                                                      
REMARK 465     THR C   568                                                      
REMARK 465     LYS C   569                                                      
REMARK 465     GLN C   570                                                      
REMARK 465     CYS C   571                                                      
REMARK 465     PRO C   572                                                      
REMARK 465     CYS C   573                                                      
REMARK 465     TYR C   574                                                      
REMARK 465     LEU C   575                                                      
REMARK 465     ALA C   576                                                      
REMARK 465     VAL C   577                                                      
REMARK 465     ARG C   578                                                      
REMARK 465     GLU C   579                                                      
REMARK 465     CYS C   580                                                      
REMARK 465     ASP C   581                                                      
REMARK 465     PRO C   582                                                      
REMARK 465     ASP C   583                                                      
REMARK 465     LEU C   584                                                      
REMARK 465     CYS C   585                                                      
REMARK 465     LEU C   586                                                      
REMARK 465     THR C   587                                                      
REMARK 465     CYS C   588                                                      
REMARK 465     GLY C   589                                                      
REMARK 465     ALA C   590                                                      
REMARK 465     ALA C   591                                                      
REMARK 465     ASP C   592                                                      
REMARK 465     HIS C   593                                                      
REMARK 465     TRP C   594                                                      
REMARK 465     ASP C   595                                                      
REMARK 465     SER C   596                                                      
REMARK 465     LYS C   597                                                      
REMARK 465     ASN C   598                                                      
REMARK 465     VAL C   599                                                      
REMARK 465     SER C   600                                                      
REMARK 465     CYS C   601                                                      
REMARK 465     LYS C   602                                                      
REMARK 465     ASN C   603                                                      
REMARK 465     CYS C   604                                                      
REMARK 465     SER C   605                                                      
REMARK 465     ILE C   606                                                      
REMARK 465     GLN C   607                                                      
REMARK 465     ARG C   608                                                      
REMARK 465     GLY C   609                                                      
REMARK 465     SER C   610                                                      
REMARK 465     LYS C   611                                                      
REMARK 465     LYS C   612                                                      
REMARK 465     HIS C   613                                                      
REMARK 465     LEU C   614                                                      
REMARK 465     LEU C   615                                                      
REMARK 465     LEU C   616                                                      
REMARK 465     ALA C   617                                                      
REMARK 465     PRO C   618                                                      
REMARK 465     SER C   619                                                      
REMARK 465     ASP C   620                                                      
REMARK 465     VAL C   621                                                      
REMARK 465     ALA C   622                                                      
REMARK 465     GLY C   623                                                      
REMARK 465     TRP C   624                                                      
REMARK 465     GLY C   625                                                      
REMARK 465     ILE C   626                                                      
REMARK 465     PHE C   627                                                      
REMARK 465     ILE C   628                                                      
REMARK 465     LYS C   629                                                      
REMARK 465     ASP C   630                                                      
REMARK 465     PRO C   631                                                      
REMARK 465     VAL C   632                                                      
REMARK 465     GLN C   633                                                      
REMARK 465     LYS C   634                                                      
REMARK 465     ASN C   635                                                      
REMARK 465     GLU C   636                                                      
REMARK 465     PHE C   637                                                      
REMARK 465     ILE C   638                                                      
REMARK 465     SER C   639                                                      
REMARK 465     GLU C   640                                                      
REMARK 465     TYR C   641                                                      
REMARK 465     CYS C   642                                                      
REMARK 465     GLY C   643                                                      
REMARK 465     GLU C   644                                                      
REMARK 465     ILE C   645                                                      
REMARK 465     ILE C   646                                                      
REMARK 465     SER C   647                                                      
REMARK 465     GLN C   648                                                      
REMARK 465     ASP C   649                                                      
REMARK 465     GLU C   650                                                      
REMARK 465     ALA C   651                                                      
REMARK 465     ASP C   652                                                      
REMARK 465     ARG C   653                                                      
REMARK 465     ARG C   654                                                      
REMARK 465     GLY C   655                                                      
REMARK 465     LYS C   656                                                      
REMARK 465     VAL C   657                                                      
REMARK 465     TYR C   658                                                      
REMARK 465     ASP C   659                                                      
REMARK 465     LYS C   660                                                      
REMARK 465     TYR C   661                                                      
REMARK 465     MET C   662                                                      
REMARK 465     CYS C   663                                                      
REMARK 465     SER C   664                                                      
REMARK 465     PHE C   665                                                      
REMARK 465     LEU C   666                                                      
REMARK 465     PHE C   667                                                      
REMARK 465     ASN C   668                                                      
REMARK 465     LEU C   669                                                      
REMARK 465     ASN C   670                                                      
REMARK 465     ASN C   671                                                      
REMARK 465     ASP C   672                                                      
REMARK 465     PHE C   673                                                      
REMARK 465     VAL C   674                                                      
REMARK 465     VAL C   675                                                      
REMARK 465     ASP C   676                                                      
REMARK 465     ALA C   677                                                      
REMARK 465     THR C   678                                                      
REMARK 465     ARG C   679                                                      
REMARK 465     LYS C   680                                                      
REMARK 465     GLY C   681                                                      
REMARK 465     ASN C   682                                                      
REMARK 465     LYS C   683                                                      
REMARK 465     ILE C   684                                                      
REMARK 465     ARG C   685                                                      
REMARK 465     PHE C   686                                                      
REMARK 465     ALA C   687                                                      
REMARK 465     ASN C   688                                                      
REMARK 465     HIS C   689                                                      
REMARK 465     SER C   690                                                      
REMARK 465     VAL C   691                                                      
REMARK 465     ASN C   692                                                      
REMARK 465     PRO C   693                                                      
REMARK 465     ASN C   694                                                      
REMARK 465     CYS C   695                                                      
REMARK 465     TYR C   696                                                      
REMARK 465     ALA C   697                                                      
REMARK 465     LYS C   698                                                      
REMARK 465     VAL C   699                                                      
REMARK 465     MET C   700                                                      
REMARK 465     MET C   701                                                      
REMARK 465     VAL C   702                                                      
REMARK 465     ASN C   703                                                      
REMARK 465     GLY C   704                                                      
REMARK 465     ASP C   705                                                      
REMARK 465     HIS C   706                                                      
REMARK 465     ARG C   707                                                      
REMARK 465     ILE C   708                                                      
REMARK 465     GLY C   709                                                      
REMARK 465     ILE C   710                                                      
REMARK 465     PHE C   711                                                      
REMARK 465     ALA C   712                                                      
REMARK 465     LYS C   713                                                      
REMARK 465     ARG C   714                                                      
REMARK 465     ALA C   715                                                      
REMARK 465     ILE C   716                                                      
REMARK 465     GLN C   717                                                      
REMARK 465     THR C   718                                                      
REMARK 465     GLY C   719                                                      
REMARK 465     GLU C   720                                                      
REMARK 465     GLU C   721                                                      
REMARK 465     LEU C   722                                                      
REMARK 465     PHE C   723                                                      
REMARK 465     PHE C   724                                                      
REMARK 465     ASP C   725                                                      
REMARK 465     TYR C   726                                                      
REMARK 465     ARG C   727                                                      
REMARK 465     TYR C   728                                                      
REMARK 465     SER C   729                                                      
REMARK 465     GLN C   730                                                      
REMARK 465     ALA C   731                                                      
REMARK 465     ASP C   732                                                      
REMARK 465     ALA C   733                                                      
REMARK 465     LEU C   734                                                      
REMARK 465     LYS C   735                                                      
REMARK 465     TYR C   736                                                      
REMARK 465     VAL C   737                                                      
REMARK 465     GLY C   738                                                      
REMARK 465     ILE C   739                                                      
REMARK 465     GLU C   740                                                      
REMARK 465     ARG C   741                                                      
REMARK 465     GLU C   742                                                      
REMARK 465     MET C   743                                                      
REMARK 465     GLU C   744                                                      
REMARK 465     ILE C   745                                                      
REMARK 465     PRO C   746                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     LEU A 426    CG   CD1  CD2                                       
REMARK 470     ASN A 435    CG   OD1  ND2                                       
REMARK 470     ASN A 436    CG   OD1  ND2                                       
REMARK 470     ASN A 437    CG   OD1  ND2                                       
REMARK 470     ARG A 439    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN A 440    CG   CD   OE1  NE2                                  
REMARK 470     GLN A 441    CG   CD   OE1  NE2                                  
REMARK 470     GLU A 443    CG   CD   OE1  OE2                                  
REMARK 470     ARG A 445    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     TYR A 480    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     HIS A 481    CG   ND1  CD2  CE1  NE2                             
REMARK 470     LYS A 483    CG   CD   CE   NZ                                   
REMARK 470     ASP A 488    CG   OD1  OD2                                       
REMARK 470     SER A 490    OG                                                  
REMARK 470     ILE A 491    CG1  CG2  CD1                                       
REMARK 470     GLU A 493    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 496    CG   OD1  OD2                                       
REMARK 470     ASN A 502    CG   OD1  ND2                                       
REMARK 470     PRO A 503    CG   CD                                             
REMARK 470     GLN A 504    CG   CD   OE1  NE2                                  
REMARK 470     ASP A 505    CG   OD1  OD2                                       
REMARK 470     ILE A 506    CG1  CG2  CD1                                       
REMARK 470     HIS A 507    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN A 509    CG   CD   OE1  NE2                                  
REMARK 470     PHE A 512    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ARG A 516    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN A 517    CG   OD1  ND2                                       
REMARK 470     LYS A 521    CG   CD   CE   NZ                                   
REMARK 470     ARG A 522    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ILE A 528    CG1  CG2  CD1                                       
REMARK 470     ARG A 532    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS A 534    CG   CD   CE   NZ                                   
REMARK 470     LYS A 537    CG   CD   CE   NZ                                   
REMARK 470     MET A 540    CG   SD   CE                                        
REMARK 470     LEU A 544    CG   CD1  CD2                                       
REMARK 470     GLU A 545    CG   CD   OE1  OE2                                  
REMARK 470     SER A 546    OG                                                  
REMARK 470     GLU A 547    CG   CD   OE1  OE2                                  
REMARK 470     ASP A 548    CG   OD1  OD2                                       
REMARK 470     ARG B 115    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN B 119    CG   CD   OE1  NE2                                  
REMARK 470     GLN E 143    CG   CD   OE1  NE2                                  
REMARK 470     LYS E 151    CG   CD   CE   NZ                                   
REMARK 470     PHE E 157    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     PHE E 160    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LEU E 161    CG   CD1  CD2                                       
REMARK 470     ARG E 164    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU K 259    CG   CD   OE1  OE2                                  
REMARK 470     LYS K 270    CG   CD   CE   NZ                                   
REMARK 470     SER K 271    OG                                                  
REMARK 470     VAL K 272    CG1  CG2                                            
REMARK 470     ARG K 274    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     SER K 280    OG                                                  
REMARK 470     ARG K 287    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS K 291    CG   CD   CE   NZ                                   
REMARK 470     TYR K 292    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     HIS K 300    CG   ND1  CD2  CE1  NE2                             
REMARK 470     THR K 302    OG1  CG2                                            
REMARK 470     ASN K 304    CG   OD1  ND2                                       
REMARK 470     THR K 305    OG1  CG2                                            
REMARK 470     ASN K 423    CG   OD1  ND2                                       
REMARK 470     ILE K 424    CG1  CG2  CD1                                       
REMARK 470     GLU K 425    CG   CD   OE1  OE2                                  
REMARK 470     GLU K 428    CG   CD   OE1  OE2                                  
REMARK 470     ASN K 429    CG   OD1  ND2                                       
REMARK 470     VAL K 430    CG1  CG2                                            
REMARK 470     GLU K 431    CG   CD   OE1  OE2                                  
REMARK 470     SER K 433    OG                                                  
REMARK 470     GLU K 436    CG   CD   OE1  OE2                                  
REMARK 470     SER K 438    OG                                                  
REMARK 470     MET K 439    CG   SD   CE                                        
REMARK 470     PHE K 440    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     ASN K 450    CG   OD1  ND2                                       
REMARK 470     THR K 460    OG1  CG2                                            
REMARK 470     ARG K 464    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN K 465    CG   CD   OE1  NE2                                  
REMARK 470     GLU K 468    CG   CD   OE1  OE2                                  
REMARK 470     LYS K 472    CG   CD   CE   NZ                                   
REMARK 470     ILE K 476    CG1  CG2  CD1                                       
REMARK 470     ILE K 477    CG1  CG2  CD1                                       
REMARK 470     SER K 514    OG                                                  
REMARK 470     ASN K 515    CG   OD1  ND2                                       
REMARK 470     ASP K 524    CG   OD1  OD2                                       
REMARK 470     ARG K 527    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLN K 528    CG   CD   OE1  NE2                                  
REMARK 470     ASP K 531    CG   OD1  OD2                                       
REMARK 470     SER K 532    OG                                                  
REMARK 470     SER K 533    OG                                                  
REMARK 470     VAL K 537    CG1  CG2                                            
REMARK 470     GLN K 540    CG   CD   OE1  NE2                                  
REMARK 470     ASN K 541    CG   OD1  ND2                                       
REMARK 470     GLU K 544    CG   CD   OE1  OE2                                  
REMARK 470     GLU K 552    CG   CD   OE1  OE2                                  
REMARK 470     GLN K 554    CG   CD   OE1  NE2                                  
REMARK 470     ARG K 556    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     LYS K 563    CG   CD   CE   NZ                                   
REMARK 470     LYS K 569    CG   CD   CE   NZ                                   
REMARK 470     GLN K 570    CG   CD   OE1  NE2                                  
REMARK 470     ASP K 595    CG   OD1  OD2                                       
REMARK 470     LYS K 656    CG   CD   CE   NZ                                   
REMARK 470     ASN K 671    CG   OD1  ND2                                       
REMARK 470     LEU K 734    CG   CD1  CD2                                       
REMARK 470     LYS K 735    CG   CD   CE   NZ                                   
REMARK 470     LYS L 106    CG   CD   CE   NZ                                   
REMARK 470     GLU L 107    CG   CD   OE1  OE2                                  
REMARK 470     GLN L 129    CG   CD   OE1  NE2                                  
REMARK 470     GLU L 131    CG   CD   OE1  OE2                                  
REMARK 470     ARG L 133    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     ASN L 157    CG   OD1  ND2                                       
REMARK 470     ASP L 212    CG   OD1  OD2                                       
REMARK 470     ASP L 223    CG   OD1  OD2                                       
REMARK 470     GLU L 249    CG   CD   OE1  OE2                                  
REMARK 470     MET L 271    CG   SD   CE                                        
REMARK 470     VAL L 393    CG1  CG2                                            
REMARK 470     GLU L 394    CG   CD   OE1  OE2                                  
REMARK 470     LYS L 400    CG   CD   CE   NZ                                   
REMARK 470     ARG L 441    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     GLU M 578    CG   CD   OE1  OE2                                  
REMARK 470     GLU M 580    CG   CD   OE1  OE2                                  
REMARK 470     VAL M 581    CG1  CG2                                            
REMARK 470     ASP M 582    CG   OD1  OD2                                       
REMARK 470     GLU M 590    CG   CD   OE1  OE2                                  
REMARK 470     GLU M 608    CG   CD   OE1  OE2                                  
REMARK 470     GLN M 645    CG   CD   OE1  NE2                                  
REMARK 470     ILE M 648    CG1  CG2  CD1                                       
REMARK 470     LYS M 649    CG   CD   CE   NZ                                   
REMARK 470     ASN M 651    CG   OD1  ND2                                       
REMARK 470     ARG M 654    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     MET M 657    CG   SD   CE                                        
REMARK 470     ILE M 671    CG1  CG2  CD1                                       
REMARK 470     MET M 672    CG   SD   CE                                        
REMARK 470     LYS M 680    CG   CD   CE   NZ                                   
REMARK 470     ASP N  90    CG   OD1  OD2                                       
REMARK 470     SER N 112    OG                                                  
REMARK 470     GLU N 124    CG   CD   OE1  OE2                                  
REMARK 470     LYS N 212    CG   CD   CE   NZ                                   
REMARK 470     GLU N 213    CG   CD   OE1  OE2                                  
REMARK 470     GLU P 232    CG   CD   OE1  OE2                                  
REMARK 470     ILE P 237    CG1  CG2  CD1                                       
REMARK 470     LEU P 240    CG   CD1  CD2                                       
REMARK 470     TRP P 243    CG   CD1  CD2  NE1  CE2  CE3  CZ2                   
REMARK 470     TRP P 243    CZ3  CH2                                            
REMARK 470     GLU P 258    CG   CD   OE1  OE2                                  
REMARK 470     HIS P 260    CG   ND1  CD2  CE1  NE2                             
REMARK 470     GLN P 261    CG   CD   OE1  NE2                                  
REMARK 470     LEU P 262    CG   CD1  CD2                                       
REMARK 470     LYS P 263    CG   CD   CE   NZ                                   
REMARK 470     VAL P 266    CG1  CG2                                            
REMARK 470     LEU P 278    CG   CD1  CD2                                       
REMARK 470     TYR P 285    CG   CD1  CD2  CE1  CE2  CZ   OH                    
REMARK 470     GLU Q  84    CG   CD   OE1  OE2                                  
REMARK 470     GLN Q  88    CG   CD   OE1  NE2                                  
REMARK 470     GLU Q  91    CG   CD   OE1  OE2                                  
REMARK 470     LYS Q  92    CG   CD   CE   NZ                                   
REMARK 470     ARG Q 124    CG   CD   NE   CZ   NH1  NH2                        
REMARK 470     THR Q 125    OG1  CG2                                            
REMARK 470     ASN Q 126    CG   OD1  ND2                                       
REMARK 470     LYS Q 128    CG   CD   CE   NZ                                   
REMARK 470     PHE Q 132    CG   CD1  CD2  CE1  CE2  CZ                         
REMARK 470     LYS Q 133    CG   CD   CE   NZ                                   
REMARK 470     LEU Q 138    CG   CD1  CD2                                       
REMARK 470     LYS Q 140    CG   CD   CE   NZ                                   
REMARK 470     VAL Q 141    CG1  CG2                                            
REMARK 470     GLU Q 142    CG   CD   OE1  OE2                                  
REMARK 470     LYS Q 143    CG   CD   CE   NZ                                   
REMARK 470     MET Q 144    CG   SD   CE                                        
REMARK 470     LYS Q 145    CG   CD   CE   NZ                                   
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   NE2  HIS N   157     OD2  ASP N   170              1.55            
REMARK 500   CD1  TYR A   461     O    GLU A   542              1.60            
REMARK 500   OD2  ASP L   395     CA   LYS L   398              1.63            
REMARK 500   O    GLU L   125     N    ARG L   133              1.65            
REMARK 500   OD2  ASP L   395     N    LYS L   398              1.75            
REMARK 500   CB   UNK Z    25     N    UNK Z   247              1.76            
REMARK 500   ND1  HIS K   689     NE2  GLN K   730              1.81            
REMARK 500   CD2  TYR A   461     CB   GLU A   542              1.82            
REMARK 500   OD2  ASP L   395     CB   LYS L   398              1.86            
REMARK 500   OE2  GLU L    90     OH   TYR L   124              1.92            
REMARK 500   O    PHE A   543     N    SER A   546              1.97            
REMARK 500   O    TYR A   434     OG1  THR A   438              2.06            
REMARK 500   OG   SER K   647     OD1  ASP K   649              2.08            
REMARK 500   CE1  TYR K   728     CB   ALA O    25              2.10            
REMARK 500   OG   SER N   241     OD1  ASP N   256              2.11            
REMARK 500   OD2  ASP L   395     C    LYS L   398              2.13            
REMARK 500   CZ   TYR A   461     CA   GLU A   542              2.14            
REMARK 500   OD1  ASN K   635     OH   TYR K   696              2.14            
REMARK 500   O    ALA K   687     OH   TYR K   726              2.14            
REMARK 500   CZ   TYR A   461     O    GLU A   542              2.15            
REMARK 500   O    PHE K   440     CG1  ILE K   444              2.17            
REMARK 500   N    GLU L   125     O    ARG L   133              2.17            
REMARK 500   O    ASP N    60     N    ASN N    88              2.19            
REMARK 500   CZ   TYR K   728     CB   ALA O    25              2.19            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND LENGTHS                                      
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,2(A3,1X,A1,I4,A1,1X,A4,3X),1X,F6.3)               
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   RES CSSEQI ATM2   DEVIATION                     
REMARK 500    GLY Q 146   N     GLY Q 146   CA      0.105                       
REMARK 500    GLY Q 146   CA    GLY Q 146   C       0.123                       
REMARK 500    GLY Q 146   C     GLY Q 146   O       0.338                       
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500    CYS A 450   CA  -  CB  -  SG  ANGL. DEV. =   8.9 DEGREES          
REMARK 500    PRO L 396   C   -  N   -  CD  ANGL. DEV. =  15.3 DEGREES          
REMARK 500    CYS L 429   CA  -  CB  -  SG  ANGL. DEV. =   7.4 DEGREES          
REMARK 500    CYS M 571   CA  -  CB  -  SG  ANGL. DEV. =   7.4 DEGREES          
REMARK 500    LEU N  79   CB  -  CG  -  CD2 ANGL. DEV. = -10.3 DEGREES          
REMARK 500    MET N 404   CB  -  CG  -  SD  ANGL. DEV. = -19.5 DEGREES          
REMARK 500    GLY Q 146   CA  -  C   -  O   ANGL. DEV. = -12.3 DEGREES          
REMARK 500    SER C  73   N   -  CA  -  C   ANGL. DEV. = -18.2 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    GLN A 431      113.80   -165.55                                   
REMARK 500    ASN A 436      -17.73     73.30                                   
REMARK 500    ASN A 437       27.69   -148.28                                   
REMARK 500    THR A 438     -167.10   -108.64                                   
REMARK 500    THR A 442      -92.37    -57.59                                   
REMARK 500    GLU A 443      166.48    152.20                                   
REMARK 500    ALA A 444      106.38   -167.72                                   
REMARK 500    TYR A 478      142.57   -172.65                                   
REMARK 500    TYR A 480      -31.35     82.15                                   
REMARK 500    HIS A 481     -176.02    151.74                                   
REMARK 500    ALA A 485      -34.35   -156.00                                   
REMARK 500    CYS A 494      -77.06    -82.96                                   
REMARK 500    TYR A 495      -30.96     67.64                                   
REMARK 500    ILE A 506      -65.31   -125.28                                   
REMARK 500    PHE A 512     -168.65   -103.76                                   
REMARK 500    ALA A 513        4.86    -69.77                                   
REMARK 500    SER A 515      -76.65    -63.80                                   
REMARK 500    ASN A 517      -74.93    -94.81                                   
REMARK 500    HIS A 527      108.97    -55.11                                   
REMARK 500    LEU A 529      124.43   -172.75                                   
REMARK 500    LYS A 534      -60.42   -108.23                                   
REMARK 500    ARG A 535      118.24   -168.94                                   
REMARK 500    LEU A 544      -52.29    -25.73                                   
REMARK 500    THR E 142       79.74     64.30                                   
REMARK 500    ILE E 144       -5.93    -47.15                                   
REMARK 500    SER E 145      -19.50    -48.77                                   
REMARK 500    ASP E 156        5.01    101.05                                   
REMARK 500    THR E 159      104.78     63.06                                   
REMARK 500    PHE E 160      -71.21     39.99                                   
REMARK 500    ARG E 164       46.77    -99.47                                   
REMARK 500    SER K 280      -70.04    -50.30                                   
REMARK 500    ASP K 293       70.33     57.34                                   
REMARK 500    PHE K 299      104.42   -162.49                                   
REMARK 500    ALA K 435       -0.16     70.37                                   
REMARK 500    ASP K 449       70.93     61.02                                   
REMARK 500    PHE K 451      -63.66   -100.28                                   
REMARK 500    THR K 460       42.53   -143.50                                   
REMARK 500    ARG K 527       49.16   -142.69                                   
REMARK 500    CYS K 549      155.84    -44.62                                   
REMARK 500    ARG K 556     -167.36    -74.30                                   
REMARK 500    THR K 568     -164.96    -79.53                                   
REMARK 500    LEU K 575      -73.11    -61.17                                   
REMARK 500    CYS K 580       89.78    -63.67                                   
REMARK 500    HIS K 593       62.35     63.22                                   
REMARK 500    CYS K 604       30.81   -143.63                                   
REMARK 500    SER K 619     -176.40    -68.35                                   
REMARK 500    VAL K 621      -60.38   -137.34                                   
REMARK 500    ILE K 638      -62.33   -106.41                                   
REMARK 500    SER K 647     -178.83    -67.05                                   
REMARK 500    MET K 662       63.07     60.86                                   
REMARK 500                                                                      
REMARK 500 THIS ENTRY HAS     170 RAMACHANDRAN OUTLIERS.                        
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: NON-CIS, NON-TRANS                                         
REMARK 500                                                                      
REMARK 500 THE FOLLOWING PEPTIDE BONDS DEVIATE SIGNIFICANTLY FROM BOTH          
REMARK 500 CIS AND TRANS CONFORMATION.  CIS BONDS, IF ANY, ARE LISTED           
REMARK 500 ON CISPEP RECORDS.  TRANS IS DEFINED AS 180 +/- 30 AND               
REMARK 500 CIS IS DEFINED AS 0 +/- 30 DEGREES.                                  
REMARK 500                                 MODEL     OMEGA                      
REMARK 500 GLN A  441     THR A  442                 -144.48                    
REMARK 500 TYR A  478     VAL A  479                  149.34                    
REMARK 500 TYR A  480     HIS A  481                  148.72                    
REMARK 500 HIS A  481     PRO A  482                  143.09                    
REMARK 500 PHE K  723     PHE K  724                  148.05                    
REMARK 500 TYR L  148     THR L  149                  142.94                    
REMARK 500 MET M  579     GLU M  580                  137.74                    
REMARK 500 ALA N  219     LYS N  220                  147.51                    
REMARK 500 LEU P  239     LEU P  240                 -148.78                    
REMARK 500 UNK Z  162     UNK Z  163                  148.87                    
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-7335   RELATED DB: EMDB                              
REMARK 900 CRYO-EM STRUCTURE OF PRC2 BOUND TO COFACTORS AEBP2 AND JARID2 IN     
REMARK 900 THE EXTENDED ACTIVE STATE                                            
REMARK 900 RELATED ID: EMD-7334   RELATED DB: EMDB                              
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 AUTHORS HAVE INDICATED THAT THE MACROMOLECULE NAME IS CORRESPONDING  
REMARK 999 TO CHAIN Z IS SUZ12. THE EXPECTED SEQUENCE FOR THIS PORTION IS:      
REMARK 999 SUZ12 AA 150 - 356                                                   
REMARK 999 SHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNP 
DBREF  6C24 A    1   739  UNP    Q15022   SUZ12_HUMAN      1    739             
DBREF  6C24 B  106   450  UNP    Q92833   JARD2_HUMAN     68    412             
DBREF  6C24 E  106   450  UNP    Q92833   JARD2_HUMAN     68    412             
DBREF  6C24 K    1   746  UNP    Q15910   EZH2_HUMAN       1    746             
DBREF  6C24 L    1   441  UNP    O75530   EED_HUMAN        1    441             
DBREF  6C24 M    1   739  UNP    Q15022   SUZ12_HUMAN      1    739             
DBREF  6C24 N    1   425  UNP    Q09028   RBBP4_HUMAN      1    425             
DBREF  6C24 O   23    29  PDB    6C24     6C24            23     29             
DBREF  6C24 P    1   295  UNP    Q6ZN18   AEBP2_HUMAN    209    503             
DBREF  6C24 Q    1   739  UNP    Q15022   SUZ12_HUMAN      1    739             
DBREF  6C24 Z   15   259  PDB    6C24     6C24            15    259             
DBREF  6C24 C    1   746  UNP    Q15910   EZH2_HUMAN       1    746             
SEQRES   1 A  739  MET ALA PRO GLN LYS HIS GLY GLY GLY GLY GLY GLY GLY          
SEQRES   2 A  739  SER GLY PRO SER ALA GLY SER GLY GLY GLY GLY PHE GLY          
SEQRES   3 A  739  GLY SER ALA ALA VAL ALA ALA ALA THR ALA SER GLY GLY          
SEQRES   4 A  739  LYS SER GLY GLY GLY SER CYS GLY GLY GLY GLY SER TYR          
SEQRES   5 A  739  SER ALA SER SER SER SER SER ALA ALA ALA ALA ALA GLY          
SEQRES   6 A  739  ALA ALA VAL LEU PRO VAL LYS LYS PRO LYS MET GLU HIS          
SEQRES   7 A  739  VAL GLN ALA ASP HIS GLU LEU PHE LEU GLN ALA PHE GLU          
SEQRES   8 A  739  LYS PRO THR GLN ILE TYR ARG PHE LEU ARG THR ARG ASN          
SEQRES   9 A  739  LEU ILE ALA PRO ILE PHE LEU HIS ARG THR LEU THR TYR          
SEQRES  10 A  739  MET SER HIS ARG ASN SER ARG THR ASN ILE LYS ARG LYS          
SEQRES  11 A  739  THR PHE LYS VAL ASP ASP MET LEU SER LYS VAL GLU LYS          
SEQRES  12 A  739  MET LYS GLY GLU GLN GLU SER HIS SER LEU SER ALA HIS          
SEQRES  13 A  739  LEU GLN LEU THR PHE THR GLY PHE PHE HIS LYS ASN ASP          
SEQRES  14 A  739  LYS PRO SER PRO ASN SER GLU ASN GLU GLN ASN SER VAL          
SEQRES  15 A  739  THR LEU GLU VAL LEU LEU VAL LYS VAL CYS HIS LYS LYS          
SEQRES  16 A  739  ARG LYS ASP VAL SER CYS PRO ILE ARG GLN VAL PRO THR          
SEQRES  17 A  739  GLY LYS LYS GLN VAL PRO LEU ASN PRO ASP LEU ASN GLN          
SEQRES  18 A  739  THR LYS PRO GLY ASN PHE PRO SER LEU ALA VAL SER SER          
SEQRES  19 A  739  ASN GLU PHE GLU PRO SER ASN SER HIS MET VAL LYS SER          
SEQRES  20 A  739  TYR SER LEU LEU PHE ARG VAL THR ARG PRO GLY ARG ARG          
SEQRES  21 A  739  GLU PHE ASN GLY MET ILE ASN GLY GLU THR ASN GLU ASN          
SEQRES  22 A  739  ILE ASP VAL ASN GLU GLU LEU PRO ALA ARG ARG LYS ARG          
SEQRES  23 A  739  ASN ARG GLU ASP GLY GLU LYS THR PHE VAL ALA GLN MET          
SEQRES  24 A  739  THR VAL PHE ASP LYS ASN ARG ARG LEU GLN LEU LEU ASP          
SEQRES  25 A  739  GLY GLU TYR GLU VAL ALA MET GLN GLU MET GLU GLU CYS          
SEQRES  26 A  739  PRO ILE SER LYS LYS ARG ALA THR TRP GLU THR ILE LEU          
SEQRES  27 A  739  ASP GLY LYS ARG LEU PRO PRO PHE GLU THR PHE SER GLN          
SEQRES  28 A  739  GLY PRO THR LEU GLN PHE THR LEU ARG TRP THR GLY GLU          
SEQRES  29 A  739  THR ASN ASP LYS SER THR ALA PRO ILE ALA LYS PRO LEU          
SEQRES  30 A  739  ALA THR ARG ASN SER GLU SER LEU HIS GLN GLU ASN LYS          
SEQRES  31 A  739  PRO GLY SER VAL LYS PRO THR GLN THR ILE ALA VAL LYS          
SEQRES  32 A  739  GLU SER LEU THR THR ASP LEU GLN THR ARG LYS GLU LYS          
SEQRES  33 A  739  ASP THR PRO ASN GLU ASN ARG GLN LYS LEU ARG ILE PHE          
SEQRES  34 A  739  TYR GLN PHE LEU TYR ASN ASN ASN THR ARG GLN GLN THR          
SEQRES  35 A  739  GLU ALA ARG ASP ASP LEU HIS CYS PRO TRP CYS THR LEU          
SEQRES  36 A  739  ASN CYS ARG LYS LEU TYR SER LEU LEU LYS HIS LEU LYS          
SEQRES  37 A  739  LEU CYS HIS SER ARG PHE ILE PHE ASN TYR VAL TYR HIS          
SEQRES  38 A  739  PRO LYS GLY ALA ARG ILE ASP VAL SER ILE ASN GLU CYS          
SEQRES  39 A  739  TYR ASP GLY SER TYR ALA GLY ASN PRO GLN ASP ILE HIS          
SEQRES  40 A  739  ARG GLN PRO GLY PHE ALA PHE SER ARG ASN GLY PRO VAL          
SEQRES  41 A  739  LYS ARG THR PRO ILE THR HIS ILE LEU VAL CYS ARG PRO          
SEQRES  42 A  739  LYS ARG THR LYS ALA SER MET SER GLU PHE LEU GLU SER          
SEQRES  43 A  739  GLU ASP GLY GLU VAL GLU GLN GLN ARG THR TYR SER SER          
SEQRES  44 A  739  GLY HIS ASN ARG LEU TYR PHE HIS SER ASP THR CYS LEU          
SEQRES  45 A  739  PRO LEU ARG PRO GLN GLU MET GLU VAL ASP SER GLU ASP          
SEQRES  46 A  739  GLU LYS ASP PRO GLU TRP LEU ARG GLU LYS THR ILE THR          
SEQRES  47 A  739  GLN ILE GLU GLU PHE SER ASP VAL ASN GLU GLY GLU LYS          
SEQRES  48 A  739  GLU VAL MET LYS LEU TRP ASN LEU HIS VAL MET LYS HIS          
SEQRES  49 A  739  GLY PHE ILE ALA ASP ASN GLN MET ASN HIS ALA CYS MET          
SEQRES  50 A  739  LEU PHE VAL GLU ASN TYR GLY GLN LYS ILE ILE LYS LYS          
SEQRES  51 A  739  ASN LEU CYS ARG ASN PHE MET LEU HIS LEU VAL SER MET          
SEQRES  52 A  739  HIS ASP PHE ASN LEU ILE SER ILE MET SER ILE ASP LYS          
SEQRES  53 A  739  ALA VAL THR LYS LEU ARG GLU MET GLN GLN LYS LEU GLU          
SEQRES  54 A  739  LYS GLY GLU SER ALA SER PRO ALA ASN GLU GLU ILE THR          
SEQRES  55 A  739  GLU GLU GLN ASN GLY THR ALA ASN GLY PHE SER GLU ILE          
SEQRES  56 A  739  ASN SER LYS GLU LYS ALA LEU GLU THR ASP SER VAL SER          
SEQRES  57 A  739  GLY VAL SER LYS GLN SER LYS LYS GLN LYS LEU                  
SEQRES   1 B  345  ARG LYS ARG PRO ARG LEU GLN ALA GLN ARG M3L PHE ALA          
SEQRES   2 B  345  GLN SER GLN PRO ASN SER PRO SER THR THR PRO VAL LYS          
SEQRES   3 B  345  ILE VAL GLU PRO LEU LEU PRO PRO PRO ALA THR GLN ILE          
SEQRES   4 B  345  SER ASP LEU SER LYS ARG LYS PRO LYS THR GLU ASP PHE          
SEQRES   5 B  345  LEU THR PHE LEU CYS LEU ARG GLY SER PRO ALA LEU PRO          
SEQRES   6 B  345  ASN SER MET VAL TYR PHE GLY SER SER GLN ASP GLU GLU          
SEQRES   7 B  345  GLU VAL GLU GLU GLU ASP ASP GLU THR GLU ASP VAL LYS          
SEQRES   8 B  345  THR ALA THR ASN ASN ALA SER SER SER CYS GLN SER THR          
SEQRES   9 B  345  PRO ARG LYS GLY LYS THR HIS LYS HIS VAL HIS ASN GLY          
SEQRES  10 B  345  HIS VAL PHE ASN GLY SER SER ARG SER THR ARG GLU LYS          
SEQRES  11 B  345  GLU PRO VAL GLN LYS HIS LYS SER LYS GLU ALA THR PRO          
SEQRES  12 B  345  ALA LYS GLU LYS HIS SER ASP HIS ARG ALA ASP SER ARG          
SEQRES  13 B  345  ARG GLU GLN ALA SER ALA ASN HIS PRO ALA ALA ALA PRO          
SEQRES  14 B  345  SER THR GLY SER SER ALA LYS GLY LEU ALA ALA THR HIS          
SEQRES  15 B  345  HIS HIS PRO PRO LEU HIS ARG SER ALA GLN ASP LEU ARG          
SEQRES  16 B  345  LYS GLN VAL SER LYS VAL ASN GLY VAL THR ARG MET SER          
SEQRES  17 B  345  SER LEU GLY ALA GLY VAL THR SER ALA LYS LYS MET ARG          
SEQRES  18 B  345  GLU VAL ARG PRO SER PRO SER LYS THR VAL LYS TYR THR          
SEQRES  19 B  345  ALA THR VAL THR LYS GLY ALA VAL THR TYR THR LYS ALA          
SEQRES  20 B  345  LYS ARG GLU LEU VAL LYS ASP THR LYS PRO ASN HIS HIS          
SEQRES  21 B  345  LYS PRO SER SER ALA VAL ASN HIS THR ILE SER GLY LYS          
SEQRES  22 B  345  THR GLU SER SER ASN ALA LYS THR ARG LYS GLN VAL LEU          
SEQRES  23 B  345  SER LEU GLY GLY ALA SER LYS SER THR GLY PRO ALA VAL          
SEQRES  24 B  345  ASN GLY LEU LYS VAL SER GLY ARG LEU ASN PRO LYS SER          
SEQRES  25 B  345  CYS THR LYS GLU VAL GLY GLY ARG GLN LEU ARG GLU GLY          
SEQRES  26 B  345  LEU GLN LEU ARG GLU GLY LEU ARG ASN SER LYS ARG ARG          
SEQRES  27 B  345  LEU GLU GLU ALA HIS GLN ALA                                  
SEQRES   1 E  345  ARG LYS ARG PRO ARG LEU GLN ALA GLN ARG LYS PHE ALA          
SEQRES   2 E  345  GLN SER GLN PRO ASN SER PRO SER THR THR PRO VAL LYS          
SEQRES   3 E  345  ILE VAL GLU PRO LEU LEU PRO PRO PRO ALA THR GLN ILE          
SEQRES   4 E  345  SER ASP LEU SER LYS ARG LYS PRO LYS THR GLU ASP PHE          
SEQRES   5 E  345  LEU THR PHE LEU CYS LEU ARG GLY SER PRO ALA LEU PRO          
SEQRES   6 E  345  ASN SER MET VAL TYR PHE GLY SER SER GLN ASP GLU GLU          
SEQRES   7 E  345  GLU VAL GLU GLU GLU ASP ASP GLU THR GLU ASP VAL LYS          
SEQRES   8 E  345  THR ALA THR ASN ASN ALA SER SER SER CYS GLN SER THR          
SEQRES   9 E  345  PRO ARG LYS GLY LYS THR HIS LYS HIS VAL HIS ASN GLY          
SEQRES  10 E  345  HIS VAL PHE ASN GLY SER SER ARG SER THR ARG GLU LYS          
SEQRES  11 E  345  GLU PRO VAL GLN LYS HIS LYS SER LYS GLU ALA THR PRO          
SEQRES  12 E  345  ALA LYS GLU LYS HIS SER ASP HIS ARG ALA ASP SER ARG          
SEQRES  13 E  345  ARG GLU GLN ALA SER ALA ASN HIS PRO ALA ALA ALA PRO          
SEQRES  14 E  345  SER THR GLY SER SER ALA LYS GLY LEU ALA ALA THR HIS          
SEQRES  15 E  345  HIS HIS PRO PRO LEU HIS ARG SER ALA GLN ASP LEU ARG          
SEQRES  16 E  345  LYS GLN VAL SER LYS VAL ASN GLY VAL THR ARG MET SER          
SEQRES  17 E  345  SER LEU GLY ALA GLY VAL THR SER ALA LYS LYS MET ARG          
SEQRES  18 E  345  GLU VAL ARG PRO SER PRO SER LYS THR VAL LYS TYR THR          
SEQRES  19 E  345  ALA THR VAL THR LYS GLY ALA VAL THR TYR THR LYS ALA          
SEQRES  20 E  345  LYS ARG GLU LEU VAL LYS ASP THR LYS PRO ASN HIS HIS          
SEQRES  21 E  345  LYS PRO SER SER ALA VAL ASN HIS THR ILE SER GLY LYS          
SEQRES  22 E  345  THR GLU SER SER ASN ALA LYS THR ARG LYS GLN VAL LEU          
SEQRES  23 E  345  SER LEU GLY GLY ALA SER LYS SER THR GLY PRO ALA VAL          
SEQRES  24 E  345  ASN GLY LEU LYS VAL SER GLY ARG LEU ASN PRO LYS SER          
SEQRES  25 E  345  CYS THR LYS GLU VAL GLY GLY ARG GLN LEU ARG GLU GLY          
SEQRES  26 E  345  LEU GLN LEU ARG GLU GLY LEU ARG ASN SER LYS ARG ARG          
SEQRES  27 E  345  LEU GLU GLU ALA HIS GLN ALA                                  
SEQRES   1 K  746  MET GLY GLN THR GLY LYS LYS SER GLU LYS GLY PRO VAL          
SEQRES   2 K  746  CYS TRP ARG LYS ARG VAL LYS SER GLU TYR MET ARG LEU          
SEQRES   3 K  746  ARG GLN LEU LYS ARG PHE ARG ARG ALA ASP GLU VAL LYS          
SEQRES   4 K  746  SER MET PHE SER SER ASN ARG GLN LYS ILE LEU GLU ARG          
SEQRES   5 K  746  THR GLU ILE LEU ASN GLN GLU TRP LYS GLN ARG ARG ILE          
SEQRES   6 K  746  GLN PRO VAL HIS ILE LEU THR SER VAL SER SER LEU ARG          
SEQRES   7 K  746  GLY THR ARG GLU CYS SER VAL THR SER ASP LEU ASP PHE          
SEQRES   8 K  746  PRO THR GLN VAL ILE PRO LEU LYS THR LEU ASN ALA VAL          
SEQRES   9 K  746  ALA SER VAL PRO ILE MET TYR SER TRP SER PRO LEU GLN          
SEQRES  10 K  746  GLN ASN PHE MET VAL GLU ASP GLU THR VAL LEU HIS ASN          
SEQRES  11 K  746  ILE PRO TYR MET GLY ASP GLU VAL LEU ASP GLN ASP GLY          
SEQRES  12 K  746  THR PHE ILE GLU GLU LEU ILE LYS ASN TYR ASP GLY LYS          
SEQRES  13 K  746  VAL HIS GLY ASP ARG GLU CYS GLY PHE ILE ASN ASP GLU          
SEQRES  14 K  746  ILE PHE VAL GLU LEU VAL ASN ALA LEU GLY GLN TYR ASN          
SEQRES  15 K  746  ASP ASP ASP ASP ASP ASP ASP GLY ASP ASP PRO GLU GLU          
SEQRES  16 K  746  ARG GLU GLU LYS GLN LYS ASP LEU GLU ASP HIS ARG ASP          
SEQRES  17 K  746  ASP LYS GLU SER ARG PRO PRO ARG LYS PHE PRO SER ASP          
SEQRES  18 K  746  LYS ILE PHE GLU ALA ILE SER SER MET PHE PRO ASP LYS          
SEQRES  19 K  746  GLY THR ALA GLU GLU LEU LYS GLU LYS TYR LYS GLU LEU          
SEQRES  20 K  746  THR GLU GLN GLN LEU PRO GLY ALA LEU PRO PRO GLU CYS          
SEQRES  21 K  746  THR PRO ASN ILE ASP GLY PRO ASN ALA LYS SER VAL GLN          
SEQRES  22 K  746  ARG GLU GLN SER LEU HIS SER PHE HIS THR LEU PHE CYS          
SEQRES  23 K  746  ARG ARG CYS PHE LYS TYR ASP CYS PHE LEU HIS PRO PHE          
SEQRES  24 K  746  HIS ALA THR PRO ASN THR TYR LYS ARG LYS ASN THR GLU          
SEQRES  25 K  746  THR ALA LEU ASP ASN LYS PRO CYS GLY PRO GLN CYS TYR          
SEQRES  26 K  746  GLN HIS LEU GLU GLY ALA LYS GLU PHE ALA ALA ALA LEU          
SEQRES  27 K  746  THR ALA GLU ARG ILE LYS THR PRO PRO LYS ARG PRO GLY          
SEQRES  28 K  746  GLY ARG ARG ARG GLY ARG LEU PRO ASN ASN SER SER ARG          
SEQRES  29 K  746  PRO SER THR PRO THR ILE ASN VAL LEU GLU SER LYS ASP          
SEQRES  30 K  746  THR ASP SER ASP ARG GLU ALA GLY THR GLU THR GLY GLY          
SEQRES  31 K  746  GLU ASN ASN ASP LYS GLU GLU GLU GLU LYS LYS ASP GLU          
SEQRES  32 K  746  THR SER SER SER SER GLU ALA ASN SER ARG CYS GLN THR          
SEQRES  33 K  746  PRO ILE LYS MET LYS PRO ASN ILE GLU PRO PRO GLU ASN          
SEQRES  34 K  746  VAL GLU TRP SER GLY ALA GLU ALA SER MET PHE ARG VAL          
SEQRES  35 K  746  LEU ILE GLY THR TYR TYR ASP ASN PHE CYS ALA ILE ALA          
SEQRES  36 K  746  ARG LEU ILE GLY THR LYS THR CYS ARG GLN VAL TYR GLU          
SEQRES  37 K  746  PHE ARG VAL LYS GLU SER SER ILE ILE ALA PRO ALA PRO          
SEQRES  38 K  746  ALA GLU ASP VAL ASP THR PRO PRO ARG LYS LYS LYS ARG          
SEQRES  39 K  746  LYS HIS ARG LEU TRP ALA ALA HIS CYS ARG LYS ILE GLN          
SEQRES  40 K  746  LEU LYS LYS ASP GLY SER SER ASN HIS VAL TYR ASN TYR          
SEQRES  41 K  746  GLN PRO CYS ASP HIS PRO ARG GLN PRO CYS ASP SER SER          
SEQRES  42 K  746  CYS PRO CYS VAL ILE ALA GLN ASN PHE CYS GLU LYS PHE          
SEQRES  43 K  746  CYS GLN CYS SER SER GLU CYS GLN ASN ARG PHE PRO GLY          
SEQRES  44 K  746  CYS ARG CYS LYS ALA GLN CYS ASN THR LYS GLN CYS PRO          
SEQRES  45 K  746  CYS TYR LEU ALA VAL ARG GLU CYS ASP PRO ASP LEU CYS          
SEQRES  46 K  746  LEU THR CYS GLY ALA ALA ASP HIS TRP ASP SER LYS ASN          
SEQRES  47 K  746  VAL SER CYS LYS ASN CYS SER ILE GLN ARG GLY SER LYS          
SEQRES  48 K  746  LYS HIS LEU LEU LEU ALA PRO SER ASP VAL ALA GLY TRP          
SEQRES  49 K  746  GLY ILE PHE ILE LYS ASP PRO VAL GLN LYS ASN GLU PHE          
SEQRES  50 K  746  ILE SER GLU TYR CYS GLY GLU ILE ILE SER GLN ASP GLU          
SEQRES  51 K  746  ALA ASP ARG ARG GLY LYS VAL TYR ASP LYS TYR MET CYS          
SEQRES  52 K  746  SER PHE LEU PHE ASN LEU ASN ASN ASP PHE VAL VAL ASP          
SEQRES  53 K  746  ALA THR ARG LYS GLY ASN LYS ILE ARG PHE ALA ASN HIS          
SEQRES  54 K  746  SER VAL ASN PRO ASN CYS TYR ALA LYS VAL MET MET VAL          
SEQRES  55 K  746  ASN GLY ASP HIS ARG ILE GLY ILE PHE ALA LYS ARG ALA          
SEQRES  56 K  746  ILE GLN THR GLY GLU GLU LEU PHE PHE ASP TYR ARG TYR          
SEQRES  57 K  746  SER GLN ALA ASP ALA LEU LYS TYR VAL GLY ILE GLU ARG          
SEQRES  58 K  746  GLU MET GLU ILE PRO                                          
SEQRES   1 L  441  MET SER GLU ARG GLU VAL SER THR ALA PRO ALA GLY THR          
SEQRES   2 L  441  ASP MET PRO ALA ALA LYS LYS GLN LYS LEU SER SER ASP          
SEQRES   3 L  441  GLU ASN SER ASN PRO ASP LEU SER GLY ASP GLU ASN ASP          
SEQRES   4 L  441  ASP ALA VAL SER ILE GLU SER GLY THR ASN THR GLU ARG          
SEQRES   5 L  441  PRO ASP THR PRO THR ASN THR PRO ASN ALA PRO GLY ARG          
SEQRES   6 L  441  LYS SER TRP GLY LYS GLY LYS TRP LYS SER LYS LYS CYS          
SEQRES   7 L  441  LYS TYR SER PHE LYS CYS VAL ASN SER LEU LYS GLU ASP          
SEQRES   8 L  441  HIS ASN GLN PRO LEU PHE GLY VAL GLN PHE ASN TRP HIS          
SEQRES   9 L  441  SER LYS GLU GLY ASP PRO LEU VAL PHE ALA THR VAL GLY          
SEQRES  10 L  441  SER ASN ARG VAL THR LEU TYR GLU CYS HIS SER GLN GLY          
SEQRES  11 L  441  GLU ILE ARG LEU LEU GLN SER TYR VAL ASP ALA ASP ALA          
SEQRES  12 L  441  ASP GLU ASN PHE TYR THR CYS ALA TRP THR TYR ASP SER          
SEQRES  13 L  441  ASN THR SER HIS PRO LEU LEU ALA VAL ALA GLY SER ARG          
SEQRES  14 L  441  GLY ILE ILE ARG ILE ILE ASN PRO ILE THR MET GLN CYS          
SEQRES  15 L  441  ILE LYS HIS TYR VAL GLY HIS GLY ASN ALA ILE ASN GLU          
SEQRES  16 L  441  LEU LYS PHE HIS PRO ARG ASP PRO ASN LEU LEU LEU SER          
SEQRES  17 L  441  VAL SER LYS ASP HIS ALA LEU ARG LEU TRP ASN ILE GLN          
SEQRES  18 L  441  THR ASP THR LEU VAL ALA ILE PHE GLY GLY VAL GLU GLY          
SEQRES  19 L  441  HIS ARG ASP GLU VAL LEU SER ALA ASP TYR ASP LEU LEU          
SEQRES  20 L  441  GLY GLU LYS ILE MET SER CYS GLY MET ASP HIS SER LEU          
SEQRES  21 L  441  LYS LEU TRP ARG ILE ASN SER LYS ARG MET MET ASN ALA          
SEQRES  22 L  441  ILE LYS GLU SER TYR ASP TYR ASN PRO ASN LYS THR ASN          
SEQRES  23 L  441  ARG PRO PHE ILE SER GLN LYS ILE HIS PHE PRO ASP PHE          
SEQRES  24 L  441  SER THR ARG ASP ILE HIS ARG ASN TYR VAL ASP CYS VAL          
SEQRES  25 L  441  ARG TRP LEU GLY ASP LEU ILE LEU SER LYS SER CYS GLU          
SEQRES  26 L  441  ASN ALA ILE VAL CYS TRP LYS PRO GLY LYS MET GLU ASP          
SEQRES  27 L  441  ASP ILE ASP LYS ILE LYS PRO SER GLU SER ASN VAL THR          
SEQRES  28 L  441  ILE LEU GLY ARG PHE ASP TYR SER GLN CYS ASP ILE TRP          
SEQRES  29 L  441  TYR MET ARG PHE SER MET ASP PHE TRP GLN LYS MET LEU          
SEQRES  30 L  441  ALA LEU GLY ASN GLN VAL GLY LYS LEU TYR VAL TRP ASP          
SEQRES  31 L  441  LEU GLU VAL GLU ASP PRO HIS LYS ALA LYS CYS THR THR          
SEQRES  32 L  441  LEU THR HIS HIS LYS CYS GLY ALA ALA ILE ARG GLN THR          
SEQRES  33 L  441  SER PHE SER ARG ASP SER SER ILE LEU ILE ALA VAL CYS          
SEQRES  34 L  441  ASP ASP ALA SER ILE TRP ARG TRP ASP ARG LEU ARG              
SEQRES   1 M  739  MET ALA PRO GLN LYS HIS GLY GLY GLY GLY GLY GLY GLY          
SEQRES   2 M  739  SER GLY PRO SER ALA GLY SER GLY GLY GLY GLY PHE GLY          
SEQRES   3 M  739  GLY SER ALA ALA VAL ALA ALA ALA THR ALA SER GLY GLY          
SEQRES   4 M  739  LYS SER GLY GLY GLY SER CYS GLY GLY GLY GLY SER TYR          
SEQRES   5 M  739  SER ALA SER SER SER SER SER ALA ALA ALA ALA ALA GLY          
SEQRES   6 M  739  ALA ALA VAL LEU PRO VAL LYS LYS PRO LYS MET GLU HIS          
SEQRES   7 M  739  VAL GLN ALA ASP HIS GLU LEU PHE LEU GLN ALA PHE GLU          
SEQRES   8 M  739  LYS PRO THR GLN ILE TYR ARG PHE LEU ARG THR ARG ASN          
SEQRES   9 M  739  LEU ILE ALA PRO ILE PHE LEU HIS ARG THR LEU THR TYR          
SEQRES  10 M  739  MET SER HIS ARG ASN SER ARG THR ASN ILE LYS ARG LYS          
SEQRES  11 M  739  THR PHE LYS VAL ASP ASP MET LEU SER LYS VAL GLU LYS          
SEQRES  12 M  739  MET LYS GLY GLU GLN GLU SER HIS SER LEU SER ALA HIS          
SEQRES  13 M  739  LEU GLN LEU THR PHE THR GLY PHE PHE HIS LYS ASN ASP          
SEQRES  14 M  739  LYS PRO SER PRO ASN SER GLU ASN GLU GLN ASN SER VAL          
SEQRES  15 M  739  THR LEU GLU VAL LEU LEU VAL LYS VAL CYS HIS LYS LYS          
SEQRES  16 M  739  ARG LYS ASP VAL SER CYS PRO ILE ARG GLN VAL PRO THR          
SEQRES  17 M  739  GLY LYS LYS GLN VAL PRO LEU ASN PRO ASP LEU ASN GLN          
SEQRES  18 M  739  THR LYS PRO GLY ASN PHE PRO SER LEU ALA VAL SER SER          
SEQRES  19 M  739  ASN GLU PHE GLU PRO SER ASN SER HIS MET VAL LYS SER          
SEQRES  20 M  739  TYR SER LEU LEU PHE ARG VAL THR ARG PRO GLY ARG ARG          
SEQRES  21 M  739  GLU PHE ASN GLY MET ILE ASN GLY GLU THR ASN GLU ASN          
SEQRES  22 M  739  ILE ASP VAL ASN GLU GLU LEU PRO ALA ARG ARG LYS ARG          
SEQRES  23 M  739  ASN ARG GLU ASP GLY GLU LYS THR PHE VAL ALA GLN MET          
SEQRES  24 M  739  THR VAL PHE ASP LYS ASN ARG ARG LEU GLN LEU LEU ASP          
SEQRES  25 M  739  GLY GLU TYR GLU VAL ALA MET GLN GLU MET GLU GLU CYS          
SEQRES  26 M  739  PRO ILE SER LYS LYS ARG ALA THR TRP GLU THR ILE LEU          
SEQRES  27 M  739  ASP GLY LYS ARG LEU PRO PRO PHE GLU THR PHE SER GLN          
SEQRES  28 M  739  GLY PRO THR LEU GLN PHE THR LEU ARG TRP THR GLY GLU          
SEQRES  29 M  739  THR ASN ASP LYS SER THR ALA PRO ILE ALA LYS PRO LEU          
SEQRES  30 M  739  ALA THR ARG ASN SER GLU SER LEU HIS GLN GLU ASN LYS          
SEQRES  31 M  739  PRO GLY SER VAL LYS PRO THR GLN THR ILE ALA VAL LYS          
SEQRES  32 M  739  GLU SER LEU THR THR ASP LEU GLN THR ARG LYS GLU LYS          
SEQRES  33 M  739  ASP THR PRO ASN GLU ASN ARG GLN LYS LEU ARG ILE PHE          
SEQRES  34 M  739  TYR GLN PHE LEU TYR ASN ASN ASN THR ARG GLN GLN THR          
SEQRES  35 M  739  GLU ALA ARG ASP ASP LEU HIS CYS PRO TRP CYS THR LEU          
SEQRES  36 M  739  ASN CYS ARG LYS LEU TYR SER LEU LEU LYS HIS LEU LYS          
SEQRES  37 M  739  LEU CYS HIS SER ARG PHE ILE PHE ASN TYR VAL TYR HIS          
SEQRES  38 M  739  PRO LYS GLY ALA ARG ILE ASP VAL SER ILE ASN GLU CYS          
SEQRES  39 M  739  TYR ASP GLY SER TYR ALA GLY ASN PRO GLN ASP ILE HIS          
SEQRES  40 M  739  ARG GLN PRO GLY PHE ALA PHE SER ARG ASN GLY PRO VAL          
SEQRES  41 M  739  LYS ARG THR PRO ILE THR HIS ILE LEU VAL CYS ARG PRO          
SEQRES  42 M  739  LYS ARG THR LYS ALA SER MET SER GLU PHE LEU GLU SER          
SEQRES  43 M  739  GLU ASP GLY GLU VAL GLU GLN GLN ARG THR TYR SER SER          
SEQRES  44 M  739  GLY HIS ASN ARG LEU TYR PHE HIS SER ASP THR CYS LEU          
SEQRES  45 M  739  PRO LEU ARG PRO GLN GLU MET GLU VAL ASP SER GLU ASP          
SEQRES  46 M  739  GLU LYS ASP PRO GLU TRP LEU ARG GLU LYS THR ILE THR          
SEQRES  47 M  739  GLN ILE GLU GLU PHE SER ASP VAL ASN GLU GLY GLU LYS          
SEQRES  48 M  739  GLU VAL MET LYS LEU TRP ASN LEU HIS VAL MET LYS HIS          
SEQRES  49 M  739  GLY PHE ILE ALA ASP ASN GLN MET ASN HIS ALA CYS MET          
SEQRES  50 M  739  LEU PHE VAL GLU ASN TYR GLY GLN LYS ILE ILE LYS LYS          
SEQRES  51 M  739  ASN LEU CYS ARG ASN PHE MET LEU HIS LEU VAL SER MET          
SEQRES  52 M  739  HIS ASP PHE ASN LEU ILE SER ILE MET SER ILE ASP LYS          
SEQRES  53 M  739  ALA VAL THR LYS LEU ARG GLU MET GLN GLN LYS LEU GLU          
SEQRES  54 M  739  LYS GLY GLU SER ALA SER PRO ALA ASN GLU GLU ILE THR          
SEQRES  55 M  739  GLU GLU GLN ASN GLY THR ALA ASN GLY PHE SER GLU ILE          
SEQRES  56 M  739  ASN SER LYS GLU LYS ALA LEU GLU THR ASP SER VAL SER          
SEQRES  57 M  739  GLY VAL SER LYS GLN SER LYS LYS GLN LYS LEU                  
SEQRES   1 N  425  MET ALA ASP LYS GLU ALA ALA PHE ASP ASP ALA VAL GLU          
SEQRES   2 N  425  GLU ARG VAL ILE ASN GLU GLU TYR LYS ILE TRP LYS LYS          
SEQRES   3 N  425  ASN THR PRO PHE LEU TYR ASP LEU VAL MET THR HIS ALA          
SEQRES   4 N  425  LEU GLU TRP PRO SER LEU THR ALA GLN TRP LEU PRO ASP          
SEQRES   5 N  425  VAL THR ARG PRO GLU GLY LYS ASP PHE SER ILE HIS ARG          
SEQRES   6 N  425  LEU VAL LEU GLY THR HIS THR SER ASP GLU GLN ASN HIS          
SEQRES   7 N  425  LEU VAL ILE ALA SER VAL GLN LEU PRO ASN ASP ASP ALA          
SEQRES   8 N  425  GLN PHE ASP ALA SER HIS TYR ASP SER GLU LYS GLY GLU          
SEQRES   9 N  425  PHE GLY GLY PHE GLY SER VAL SER GLY LYS ILE GLU ILE          
SEQRES  10 N  425  GLU ILE LYS ILE ASN HIS GLU GLY GLU VAL ASN ARG ALA          
SEQRES  11 N  425  ARG TYR MET PRO GLN ASN PRO CYS ILE ILE ALA THR LYS          
SEQRES  12 N  425  THR PRO SER SER ASP VAL LEU VAL PHE ASP TYR THR LYS          
SEQRES  13 N  425  HIS PRO SER LYS PRO ASP PRO SER GLY GLU CYS ASN PRO          
SEQRES  14 N  425  ASP LEU ARG LEU ARG GLY HIS GLN LYS GLU GLY TYR GLY          
SEQRES  15 N  425  LEU SER TRP ASN PRO ASN LEU SER GLY HIS LEU LEU SER          
SEQRES  16 N  425  ALA SER ASP ASP HIS THR ILE CYS LEU TRP ASP ILE SER          
SEQRES  17 N  425  ALA VAL PRO LYS GLU GLY LYS VAL VAL ASP ALA LYS THR          
SEQRES  18 N  425  ILE PHE THR GLY HIS THR ALA VAL VAL GLU ASP VAL SER          
SEQRES  19 N  425  TRP HIS LEU LEU HIS GLU SER LEU PHE GLY SER VAL ALA          
SEQRES  20 N  425  ASP ASP GLN LYS LEU MET ILE TRP ASP THR ARG SER ASN          
SEQRES  21 N  425  ASN THR SER LYS PRO SER HIS SER VAL ASP ALA HIS THR          
SEQRES  22 N  425  ALA GLU VAL ASN CYS LEU SER PHE ASN PRO TYR SER GLU          
SEQRES  23 N  425  PHE ILE LEU ALA THR GLY SER ALA ASP LYS THR VAL ALA          
SEQRES  24 N  425  LEU TRP ASP LEU ARG ASN LEU LYS LEU LYS LEU HIS SER          
SEQRES  25 N  425  PHE GLU SER HIS LYS ASP GLU ILE PHE GLN VAL GLN TRP          
SEQRES  26 N  425  SER PRO HIS ASN GLU THR ILE LEU ALA SER SER GLY THR          
SEQRES  27 N  425  ASP ARG ARG LEU ASN VAL TRP ASP LEU SER LYS ILE GLY          
SEQRES  28 N  425  GLU GLU GLN SER PRO GLU ASP ALA GLU ASP GLY PRO PRO          
SEQRES  29 N  425  GLU LEU LEU PHE ILE HIS GLY GLY HIS THR ALA LYS ILE          
SEQRES  30 N  425  SER ASP PHE SER TRP ASN PRO ASN GLU PRO TRP VAL ILE          
SEQRES  31 N  425  CYS SER VAL SER GLU ASP ASN ILE MET GLN VAL TRP GLN          
SEQRES  32 N  425  MET ALA GLU ASN ILE TYR ASN ASP GLU ASP PRO GLU GLY          
SEQRES  33 N  425  SER VAL ASP PRO GLU GLY GLN GLY SER                          
SEQRES   1 O    7  ALA ALA ALA ARG LYS PHE ALA                                  
SEQRES   1 P  295  MET SER SER ASP GLY GLU PRO LEU SER ARG MET ASP SER          
SEQRES   2 P  295  GLU ASP SER ILE SER SER THR ILE MET ASP VAL ASP SER          
SEQRES   3 P  295  THR ILE SER SER GLY ARG SER THR PRO ALA MET MET ASN          
SEQRES   4 P  295  GLY GLN GLY SER THR THR SER SER SER LYS ASN ILE ALA          
SEQRES   5 P  295  TYR ASN CYS CYS TRP ASP GLN CYS GLN ALA CYS PHE ASN          
SEQRES   6 P  295  SER SER PRO ASP LEU ALA ASP HIS ILE ARG SER ILE HIS          
SEQRES   7 P  295  VAL ASP GLY GLN ARG GLY GLY VAL PHE VAL CYS LEU TRP          
SEQRES   8 P  295  LYS GLY CYS LYS VAL TYR ASN THR PRO SER THR SER GLN          
SEQRES   9 P  295  SER TRP LEU GLN ARG HIS MET LEU THR HIS SER GLY ASP          
SEQRES  10 P  295  LYS PRO PHE LYS CYS VAL VAL GLY GLY CYS ASN ALA SER          
SEQRES  11 P  295  PHE ALA SER GLN GLY GLY LEU ALA ARG HIS VAL PRO THR          
SEQRES  12 P  295  HIS PHE SER GLN GLN ASN SER SER LYS VAL SER SER GLN          
SEQRES  13 P  295  PRO LYS ALA LYS GLU GLU SER PRO SER LYS ALA GLY MET          
SEQRES  14 P  295  ASN LYS ARG ARG LYS LEU LYS ASN LYS ARG ARG ARG SER          
SEQRES  15 P  295  LEU PRO ARG PRO HIS ASP PHE PHE ASP ALA GLN THR LEU          
SEQRES  16 P  295  ASP ALA ILE ARG HIS ARG ALA ILE CYS PHE ASN LEU SER          
SEQRES  17 P  295  ALA HIS ILE GLU SER LEU GLY LYS GLY HIS SER VAL VAL          
SEQRES  18 P  295  PHE HIS SER THR VAL ILE ALA LYS ARG LYS GLU ASP SER          
SEQRES  19 P  295  GLY LYS ILE LYS LEU LEU LEU HIS TRP MET PRO GLU ASP          
SEQRES  20 P  295  ILE LEU PRO ASP VAL TRP VAL ASN GLU SER GLU ARG HIS          
SEQRES  21 P  295  GLN LEU LYS THR LYS VAL VAL HIS LEU SER LYS LEU PRO          
SEQRES  22 P  295  LYS ASP THR ALA LEU LEU LEU ASP PRO ASN ILE TYR ARG          
SEQRES  23 P  295  THR MET PRO GLN LYS ARG LEU LYS ARG                          
SEQRES   1 Q  739  MET ALA PRO GLN LYS HIS GLY GLY GLY GLY GLY GLY GLY          
SEQRES   2 Q  739  SER GLY PRO SER ALA GLY SER GLY GLY GLY GLY PHE GLY          
SEQRES   3 Q  739  GLY SER ALA ALA VAL ALA ALA ALA THR ALA SER GLY GLY          
SEQRES   4 Q  739  LYS SER GLY GLY GLY SER CYS GLY GLY GLY GLY SER TYR          
SEQRES   5 Q  739  SER ALA SER SER SER SER SER ALA ALA ALA ALA ALA GLY          
SEQRES   6 Q  739  ALA ALA VAL LEU PRO VAL LYS LYS PRO LYS MET GLU HIS          
SEQRES   7 Q  739  VAL GLN ALA ASP HIS GLU LEU PHE LEU GLN ALA PHE GLU          
SEQRES   8 Q  739  LYS PRO THR GLN ILE TYR ARG PHE LEU ARG THR ARG ASN          
SEQRES   9 Q  739  LEU ILE ALA PRO ILE PHE LEU HIS ARG THR LEU THR TYR          
SEQRES  10 Q  739  MET SER HIS ARG ASN SER ARG THR ASN ILE LYS ARG LYS          
SEQRES  11 Q  739  THR PHE LYS VAL ASP ASP MET LEU SER LYS VAL GLU LYS          
SEQRES  12 Q  739  MET LYS GLY GLU GLN GLU SER HIS SER LEU SER ALA HIS          
SEQRES  13 Q  739  LEU GLN LEU THR PHE THR GLY PHE PHE HIS LYS ASN ASP          
SEQRES  14 Q  739  LYS PRO SER PRO ASN SER GLU ASN GLU GLN ASN SER VAL          
SEQRES  15 Q  739  THR LEU GLU VAL LEU LEU VAL LYS VAL CYS HIS LYS LYS          
SEQRES  16 Q  739  ARG LYS ASP VAL SER CYS PRO ILE ARG GLN VAL PRO THR          
SEQRES  17 Q  739  GLY LYS LYS GLN VAL PRO LEU ASN PRO ASP LEU ASN GLN          
SEQRES  18 Q  739  THR LYS PRO GLY ASN PHE PRO SER LEU ALA VAL SER SER          
SEQRES  19 Q  739  ASN GLU PHE GLU PRO SER ASN SER HIS MET VAL LYS SER          
SEQRES  20 Q  739  TYR SER LEU LEU PHE ARG VAL THR ARG PRO GLY ARG ARG          
SEQRES  21 Q  739  GLU PHE ASN GLY MET ILE ASN GLY GLU THR ASN GLU ASN          
SEQRES  22 Q  739  ILE ASP VAL ASN GLU GLU LEU PRO ALA ARG ARG LYS ARG          
SEQRES  23 Q  739  ASN ARG GLU ASP GLY GLU LYS THR PHE VAL ALA GLN MET          
SEQRES  24 Q  739  THR VAL PHE ASP LYS ASN ARG ARG LEU GLN LEU LEU ASP          
SEQRES  25 Q  739  GLY GLU TYR GLU VAL ALA MET GLN GLU MET GLU GLU CYS          
SEQRES  26 Q  739  PRO ILE SER LYS LYS ARG ALA THR TRP GLU THR ILE LEU          
SEQRES  27 Q  739  ASP GLY LYS ARG LEU PRO PRO PHE GLU THR PHE SER GLN          
SEQRES  28 Q  739  GLY PRO THR LEU GLN PHE THR LEU ARG TRP THR GLY GLU          
SEQRES  29 Q  739  THR ASN ASP LYS SER THR ALA PRO ILE ALA LYS PRO LEU          
SEQRES  30 Q  739  ALA THR ARG ASN SER GLU SER LEU HIS GLN GLU ASN LYS          
SEQRES  31 Q  739  PRO GLY SER VAL LYS PRO THR GLN THR ILE ALA VAL LYS          
SEQRES  32 Q  739  GLU SER LEU THR THR ASP LEU GLN THR ARG LYS GLU LYS          
SEQRES  33 Q  739  ASP THR PRO ASN GLU ASN ARG GLN LYS LEU ARG ILE PHE          
SEQRES  34 Q  739  TYR GLN PHE LEU TYR ASN ASN ASN THR ARG GLN GLN THR          
SEQRES  35 Q  739  GLU ALA ARG ASP ASP LEU HIS CYS PRO TRP CYS THR LEU          
SEQRES  36 Q  739  ASN CYS ARG LYS LEU TYR SER LEU LEU LYS HIS LEU LYS          
SEQRES  37 Q  739  LEU CYS HIS SER ARG PHE ILE PHE ASN TYR VAL TYR HIS          
SEQRES  38 Q  739  PRO LYS GLY ALA ARG ILE ASP VAL SER ILE ASN GLU CYS          
SEQRES  39 Q  739  TYR ASP GLY SER TYR ALA GLY ASN PRO GLN ASP ILE HIS          
SEQRES  40 Q  739  ARG GLN PRO GLY PHE ALA PHE SER ARG ASN GLY PRO VAL          
SEQRES  41 Q  739  LYS ARG THR PRO ILE THR HIS ILE LEU VAL CYS ARG PRO          
SEQRES  42 Q  739  LYS ARG THR LYS ALA SER MET SER GLU PHE LEU GLU SER          
SEQRES  43 Q  739  GLU ASP GLY GLU VAL GLU GLN GLN ARG THR TYR SER SER          
SEQRES  44 Q  739  GLY HIS ASN ARG LEU TYR PHE HIS SER ASP THR CYS LEU          
SEQRES  45 Q  739  PRO LEU ARG PRO GLN GLU MET GLU VAL ASP SER GLU ASP          
SEQRES  46 Q  739  GLU LYS ASP PRO GLU TRP LEU ARG GLU LYS THR ILE THR          
SEQRES  47 Q  739  GLN ILE GLU GLU PHE SER ASP VAL ASN GLU GLY GLU LYS          
SEQRES  48 Q  739  GLU VAL MET LYS LEU TRP ASN LEU HIS VAL MET LYS HIS          
SEQRES  49 Q  739  GLY PHE ILE ALA ASP ASN GLN MET ASN HIS ALA CYS MET          
SEQRES  50 Q  739  LEU PHE VAL GLU ASN TYR GLY GLN LYS ILE ILE LYS LYS          
SEQRES  51 Q  739  ASN LEU CYS ARG ASN PHE MET LEU HIS LEU VAL SER MET          
SEQRES  52 Q  739  HIS ASP PHE ASN LEU ILE SER ILE MET SER ILE ASP LYS          
SEQRES  53 Q  739  ALA VAL THR LYS LEU ARG GLU MET GLN GLN LYS LEU GLU          
SEQRES  54 Q  739  LYS GLY GLU SER ALA SER PRO ALA ASN GLU GLU ILE THR          
SEQRES  55 Q  739  GLU GLU GLN ASN GLY THR ALA ASN GLY PHE SER GLU ILE          
SEQRES  56 Q  739  ASN SER LYS GLU LYS ALA LEU GLU THR ASP SER VAL SER          
SEQRES  57 Q  739  GLY VAL SER LYS GLN SER LYS LYS GLN LYS LEU                  
SEQRES   1 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   3 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   4 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   5 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   6 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   7 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   8 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   9 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  10 Z  135  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  11 Z  135  UNK UNK UNK UNK UNK                                          
SEQRES   1 C  746  MET GLY GLN THR GLY LYS LYS SER GLU LYS GLY PRO VAL          
SEQRES   2 C  746  CYS TRP ARG LYS ARG VAL LYS SER GLU TYR MET ARG LEU          
SEQRES   3 C  746  ARG GLN LEU LYS ARG PHE ARG ARG ALA ASP GLU VAL LYS          
SEQRES   4 C  746  SER MET PHE SER SER ASN ARG GLN LYS ILE LEU GLU ARG          
SEQRES   5 C  746  THR GLU ILE LEU ASN GLN GLU TRP LYS GLN ARG ARG ILE          
SEQRES   6 C  746  GLN PRO VAL HIS ILE LEU THR SER VAL SER SER LEU ARG          
SEQRES   7 C  746  GLY THR ARG GLU CYS SER VAL THR SER ASP LEU ASP PHE          
SEQRES   8 C  746  PRO THR GLN VAL ILE PRO LEU LYS THR LEU ASN ALA VAL          
SEQRES   9 C  746  ALA SER VAL PRO ILE MET TYR SER TRP SER PRO LEU GLN          
SEQRES  10 C  746  GLN ASN PHE MET VAL GLU ASP GLU THR VAL LEU HIS ASN          
SEQRES  11 C  746  ILE PRO TYR MET GLY ASP GLU VAL LEU ASP GLN ASP GLY          
SEQRES  12 C  746  THR PHE ILE GLU GLU LEU ILE LYS ASN TYR ASP GLY LYS          
SEQRES  13 C  746  VAL HIS GLY ASP ARG GLU CYS GLY PHE ILE ASN ASP GLU          
SEQRES  14 C  746  ILE PHE VAL GLU LEU VAL ASN ALA LEU GLY GLN TYR ASN          
SEQRES  15 C  746  ASP ASP ASP ASP ASP ASP ASP GLY ASP ASP PRO GLU GLU          
SEQRES  16 C  746  ARG GLU GLU LYS GLN LYS ASP LEU GLU ASP HIS ARG ASP          
SEQRES  17 C  746  ASP LYS GLU SER ARG PRO PRO ARG LYS PHE PRO SER ASP          
SEQRES  18 C  746  LYS ILE PHE GLU ALA ILE SER SER MET PHE PRO ASP LYS          
SEQRES  19 C  746  GLY THR ALA GLU GLU LEU LYS GLU LYS TYR LYS GLU LEU          
SEQRES  20 C  746  THR GLU GLN GLN LEU PRO GLY ALA LEU PRO PRO GLU CYS          
SEQRES  21 C  746  THR PRO ASN ILE ASP GLY PRO ASN ALA LYS SER VAL GLN          
SEQRES  22 C  746  ARG GLU GLN SER LEU HIS SER PHE HIS THR LEU PHE CYS          
SEQRES  23 C  746  ARG ARG CYS PHE LYS TYR ASP CYS PHE LEU HIS PRO PHE          
SEQRES  24 C  746  HIS ALA THR PRO ASN THR TYR LYS ARG LYS ASN THR GLU          
SEQRES  25 C  746  THR ALA LEU ASP ASN LYS PRO CYS GLY PRO GLN CYS TYR          
SEQRES  26 C  746  GLN HIS LEU GLU GLY ALA LYS GLU PHE ALA ALA ALA LEU          
SEQRES  27 C  746  THR ALA GLU ARG ILE LYS THR PRO PRO LYS ARG PRO GLY          
SEQRES  28 C  746  GLY ARG ARG ARG GLY ARG LEU PRO ASN ASN SER SER ARG          
SEQRES  29 C  746  PRO SER THR PRO THR ILE ASN VAL LEU GLU SER LYS ASP          
SEQRES  30 C  746  THR ASP SER ASP ARG GLU ALA GLY THR GLU THR GLY GLY          
SEQRES  31 C  746  GLU ASN ASN ASP LYS GLU GLU GLU GLU LYS LYS ASP GLU          
SEQRES  32 C  746  THR SER SER SER SER GLU ALA ASN SER ARG CYS GLN THR          
SEQRES  33 C  746  PRO ILE LYS MET LYS PRO ASN ILE GLU PRO PRO GLU ASN          
SEQRES  34 C  746  VAL GLU TRP SER GLY ALA GLU ALA SER MET PHE ARG VAL          
SEQRES  35 C  746  LEU ILE GLY THR TYR TYR ASP ASN PHE CYS ALA ILE ALA          
SEQRES  36 C  746  ARG LEU ILE GLY THR LYS THR CYS ARG GLN VAL TYR GLU          
SEQRES  37 C  746  PHE ARG VAL LYS GLU SER SER ILE ILE ALA PRO ALA PRO          
SEQRES  38 C  746  ALA GLU ASP VAL ASP THR PRO PRO ARG LYS LYS LYS ARG          
SEQRES  39 C  746  LYS HIS ARG LEU TRP ALA ALA HIS CYS ARG LYS ILE GLN          
SEQRES  40 C  746  LEU LYS LYS ASP GLY SER SER ASN HIS VAL TYR ASN TYR          
SEQRES  41 C  746  GLN PRO CYS ASP HIS PRO ARG GLN PRO CYS ASP SER SER          
SEQRES  42 C  746  CYS PRO CYS VAL ILE ALA GLN ASN PHE CYS GLU LYS PHE          
SEQRES  43 C  746  CYS GLN CYS SER SER GLU CYS GLN ASN ARG PHE PRO GLY          
SEQRES  44 C  746  CYS ARG CYS LYS ALA GLN CYS ASN THR LYS GLN CYS PRO          
SEQRES  45 C  746  CYS TYR LEU ALA VAL ARG GLU CYS ASP PRO ASP LEU CYS          
SEQRES  46 C  746  LEU THR CYS GLY ALA ALA ASP HIS TRP ASP SER LYS ASN          
SEQRES  47 C  746  VAL SER CYS LYS ASN CYS SER ILE GLN ARG GLY SER LYS          
SEQRES  48 C  746  LYS HIS LEU LEU LEU ALA PRO SER ASP VAL ALA GLY TRP          
SEQRES  49 C  746  GLY ILE PHE ILE LYS ASP PRO VAL GLN LYS ASN GLU PHE          
SEQRES  50 C  746  ILE SER GLU TYR CYS GLY GLU ILE ILE SER GLN ASP GLU          
SEQRES  51 C  746  ALA ASP ARG ARG GLY LYS VAL TYR ASP LYS TYR MET CYS          
SEQRES  52 C  746  SER PHE LEU PHE ASN LEU ASN ASN ASP PHE VAL VAL ASP          
SEQRES  53 C  746  ALA THR ARG LYS GLY ASN LYS ILE ARG PHE ALA ASN HIS          
SEQRES  54 C  746  SER VAL ASN PRO ASN CYS TYR ALA LYS VAL MET MET VAL          
SEQRES  55 C  746  ASN GLY ASP HIS ARG ILE GLY ILE PHE ALA LYS ARG ALA          
SEQRES  56 C  746  ILE GLN THR GLY GLU GLU LEU PHE PHE ASP TYR ARG TYR          
SEQRES  57 C  746  SER GLN ALA ASP ALA LEU LYS TYR VAL GLY ILE GLU ARG          
SEQRES  58 C  746  GLU MET GLU ILE PRO                                          
MODRES 6C24 M3L B  116  LYS  MODIFIED RESIDUE                                   
HET    M3L  B 116      12                                                       
HETNAM     M3L N-TRIMETHYLLYSINE                                                
FORMUL   2  M3L    C9 H21 N2 O2 1+                                              
HELIX    1 AA1 LYS A  459  CYS A  470  1                                  12    
HELIX    2 AA2 PHE A  543  ASP A  548  1                                   6    
HELIX    3 AA3 GLN E  143  SER E  145  5                                   3    
HELIX    4 AA4 ASP E  146  LYS E  151  1                                   6    
HELIX    5 AA5 ARG K  274  SER K  277  5                                   4    
HELIX    6 AA6 LEU K  278  LEU K  284  1                                   7    
HELIX    7 AA7 ALA K  435  TYR K  448  1                                  14    
HELIX    8 AA8 CYS K  452  ILE K  458  1                                   7    
HELIX    9 AA9 THR K  462  ILE K  476  1                                  15    
HELIX   10 AB1 CYS K  534  ALA K  539  1                                   6    
HELIX   11 AB2 CYS K  571  LEU K  575  5                                   5    
HELIX   12 AB3 CYS K  604  GLY K  609  1                                   6    
HELIX   13 AB4 SER K  647  MET K  662  1                                  16    
HELIX   14 AB5 ASN K  682  ALA K  687  5                                   6    
HELIX   15 AB6 SER L  267  ASP L  279  1                                  13    
HELIX   16 AB7 ARG M  575  MET M  579  5                                   5    
HELIX   17 AB8 TRP M  591  GLU M  601  1                                  11    
HELIX   18 AB9 ASN M  607  GLY M  625  1                                  19    
HELIX   19 AC1 ASP M  629  ASN M  651  1                                  23    
HELIX   20 AC2 LEU M  652  ASP M  665  1                                  14    
HELIX   21 AC3 SER M  670  ARG M  682  1                                  13    
HELIX   22 AC4 GLU N    5  ASN N   27  1                                  23    
HELIX   23 AC5 ASN N   27  LEU N   31  1                                   5    
HELIX   24 AC6 SER N  355  GLY N  362  1                                   8    
HELIX   25 AC7 MET P  244  SER P  257  1                                  14    
HELIX   26 AC8 ALA P  277  ASP P  281  5                                   5    
HELIX   27 AC9 ASP Q   82  LEU Q  105  1                                  24    
HELIX   28 AD1 UNK Z  147  UNK Z  151  5                                   5    
HELIX   29 AD2 TRP C   15  ARG C   63  1                                  49    
HELIX   30 AD3 ASN C  167  GLN C  180  1                                  14    
HELIX   31 AD4 PRO C  219  ILE C  223  5                                   5    
HELIX   32 AD5 PHE C  224  SER C  229  1                                   6    
HELIX   33 AD6 THR C  236  LEU C  247  1                                  12    
SHEET    1 AA1 3 PHE A 432  LEU A 433  0                                        
SHEET    2 AA1 3 ASP A 488  ILE A 491  1  O  VAL A 489   N  LEU A 433           
SHEET    3 AA1 3 PHE A 474  ASN A 477 -1  N  ILE A 475   O  SER A 490           
SHEET    1 AA2 5 ILE A 528  VAL A 530  0                                        
SHEET    2 AA2 5 TYR N  32  ALA N  39 -1  O  THR N  37   N  VAL A 530           
SHEET    3 AA2 5 ILE N 398  MET N 404 -1  O  GLN N 403   N  ASP N  33           
SHEET    4 AA2 5 VAL N 389  SER N 394 -1  N  SER N 392   O  GLN N 400           
SHEET    5 AA2 5 ILE N 377  TRP N 382 -1  N  SER N 381   O  CYS N 391           
SHEET    1 AA3 2 LEU K 614  PRO K 618  0                                        
SHEET    2 AA3 2 TRP K 624  ILE K 628 -1  O  PHE K 627   N  LEU K 615           
SHEET    1 AA4 3 PHE K 637  GLU K 640  0                                        
SHEET    2 AA4 3 ASP K 705  ALA K 712 -1  O  ILE K 710   N  SER K 639           
SHEET    3 AA4 3 CYS K 695  VAL K 702 -1  N  LYS K 698   O  GLY K 709           
SHEET    1 AA5 3 ILE K 645  ILE K 646  0                                        
SHEET    2 AA5 3 VAL K 674  ASP K 676 -1  O  VAL K 674   N  ILE K 646           
SHEET    3 AA5 3 LEU K 666  ASN K 668 -1  N  PHE K 667   O  VAL K 675           
SHEET    1 AA6 2 LYS K 680  GLY K 681  0                                        
SHEET    2 AA6 2 SER C 114  PRO C 115  1  O  SER C 114   N  GLY K 681           
SHEET    1 AA7 2 ASN K 688  HIS K 689  0                                        
SHEET    2 AA7 2 PHE K 723  PHE K 724  1  O  PHE K 724   N  ASN K 688           
SHEET    1 AA8 4 VAL L  99  PHE L 101  0                                        
SHEET    2 AA8 4 PHE L 113  VAL L 116 -1  O  ALA L 114   N  GLN L 100           
SHEET    3 AA8 4 ARG L 120  THR L 122 -1  O  THR L 122   N  THR L 115           
SHEET    4 AA8 4 TYR L 138  VAL L 139 -1  O  TYR L 138   N  VAL L 121           
SHEET    1 AA9 2 GLU L 125  HIS L 127  0                                        
SHEET    2 AA9 2 GLY L 130  ARG L 133 -1  O  ARG L 133   N  GLU L 125           
SHEET    1 AB1 4 PHE L 147  TYR L 154  0                                        
SHEET    2 AB1 4 PRO L 161  GLY L 167 -1  O  ALA L 164   N  ALA L 151           
SHEET    3 AB1 4 ILE L 171  ASN L 176 -1  O  ILE L 175   N  LEU L 163           
SHEET    4 AB1 4 GLN L 181  TYR L 186 -1  O  TYR L 186   N  ILE L 172           
SHEET    1 AB2 4 GLU L 195  LYS L 197  0                                        
SHEET    2 AB2 4 LEU L 207  VAL L 209 -1  O  VAL L 209   N  GLU L 195           
SHEET    3 AB2 4 LEU L 215  ASN L 219 -1  O  ARG L 216   N  SER L 208           
SHEET    4 AB2 4 THR L 224  ALA L 227 -1  O  ALA L 227   N  LEU L 217           
SHEET    1 AB3 4 VAL L 239  TYR L 244  0                                        
SHEET    2 AB3 4 ILE L 251  GLY L 255 -1  O  CYS L 254   N  SER L 241           
SHEET    3 AB3 4 LEU L 260  TRP L 263 -1  O  LYS L 261   N  SER L 253           
SHEET    4 AB3 4 SER L 300  THR L 301 -1  O  THR L 301   N  LEU L 260           
SHEET    1 AB4 4 VAL L 309  LEU L 315  0                                        
SHEET    2 AB4 4 LEU L 318  SER L 323 -1  O  LEU L 320   N  ARG L 313           
SHEET    3 AB4 4 ALA L 327  PRO L 333 -1  O  TRP L 331   N  ILE L 319           
SHEET    4 AB4 4 VAL L 350  ASP L 357 -1  O  PHE L 356   N  ILE L 328           
SHEET    1 AB5 3 PHE L 368  MET L 370  0                                        
SHEET    2 AB5 3 MET L 376  LEU L 379 -1  O  ALA L 378   N  SER L 369           
SHEET    3 AB5 3 TYR L 387  ASP L 390 -1  O  TYR L 387   N  LEU L 379           
SHEET    1 AB6 3 ILE L 413  SER L 417  0                                        
SHEET    2 AB6 3 ILE L 424  CYS L 429 -1  O  VAL L 428   N  GLN L 415           
SHEET    3 AB6 3 TRP L 437  ASP L 438 -1  O  TRP L 437   N  LEU L 425           
SHEET    1 AB7 2 TYR M 565  PHE M 566  0                                        
SHEET    2 AB7 2 PRO M 573  LEU M 574 -1  O  LEU M 574   N  TYR M 565           
SHEET    1 AB8 4 LEU N  50  THR N  54  0                                        
SHEET    2 AB8 4 PHE N  61  ARG N  65 -1  O  ILE N  63   N  THR N  54           
SHEET    3 AB8 4 ASN N  77  PRO N  87 -1  O  VAL N  84   N  HIS N  64           
SHEET    4 AB8 4 GLU N 116  HIS N 123 -1  O  ILE N 121   N  LEU N  79           
SHEET    1 AB9 2 ALA N 141  THR N 142  0                                        
SHEET    2 AB9 2 LEU N 150  VAL N 151 -1  O  LEU N 150   N  THR N 142           
SHEET    1 AC1 4 LEU N 183  TRP N 185  0                                        
SHEET    2 AC1 4 LEU N 193  SER N 195 -1  O  LEU N 194   N  SER N 184           
SHEET    3 AC1 4 ILE N 202  TRP N 205 -1  O  TRP N 205   N  LEU N 193           
SHEET    4 AC1 4 THR N 221  PHE N 223 -1  O  PHE N 223   N  ILE N 202           
SHEET    1 AC2 4 VAL N 230  TRP N 235  0                                        
SHEET    2 AC2 4 LEU N 242  ALA N 247 -1  O  VAL N 246   N  ASP N 232           
SHEET    3 AC2 4 LYS N 251  ASP N 256 -1  O  TRP N 255   N  PHE N 243           
SHEET    4 AC2 4 HIS N 267  ASP N 270 -1  O  HIS N 267   N  ILE N 254           
SHEET    1 AC3 2 ILE N 288  LEU N 289  0                                        
SHEET    2 AC3 2 TRP N 301  ASP N 302 -1  O  TRP N 301   N  LEU N 289           
SHEET    1 AC4 2 VAL N 298  ALA N 299  0                                        
SHEET    2 AC4 2 SER N 312  PHE N 313 -1  O  PHE N 313   N  VAL N 298           
SHEET    1 AC5 4 ILE N 320  TRP N 325  0                                        
SHEET    2 AC5 4 LEU N 333  GLY N 337 -1  O  ALA N 334   N  GLN N 324           
SHEET    3 AC5 4 LEU N 342  VAL N 344 -1  O  ASN N 343   N  SER N 335           
SHEET    4 AC5 4 PHE N 368  HIS N 370 -1  O  PHE N 368   N  VAL N 344           
SHEET    1 AC6 2 UNK Z  35  UNK Z  36  0                                        
SHEET    2 AC6 2 UNK Z  62  UNK Z  63  1  O  UNK Z  62   N  UNK Z  36           
SHEET    1 AC7 2 UNK Z  59  UNK Z  60  0                                        
SHEET    2 AC7 2 UNK Z  85  UNK Z  86  1  O  UNK Z  86   N  UNK Z  59           
SSBOND   1 CYS A  450    CYS A  453                          1555   1555  2.09  
SSBOND   2 CYS K  289    CYS K  294                          1555   1555  2.02  
SSBOND   3 CYS K  523    CYS K  547                          1555   1555  2.04  
SSBOND   4 CYS K  523    CYS K  549                          1555   1555  2.05  
SSBOND   5 CYS K  530    CYS K  553                          1555   1555  2.04  
SSBOND   6 CYS K  530    CYS K  549                          1555   1555  2.04  
SSBOND   7 CYS L  409    CYS L  429                          1555   1555  2.06  
LINK         CE1 TYR A 461                 O   GLU A 542     1555   1555  1.25  
LINK         CE2 TYR A 461                 CB  GLU A 542     1555   1555  1.38  
LINK         C   ARG B 115                 N   M3L B 116     1555   1555  1.33  
LINK         C   M3L B 116                 N   PHE B 117     1555   1555  1.33  
LINK         CE1 HIS K 689                 NE2 GLN K 730     1555   1555  1.26  
CISPEP   1 ASP L  395    PRO L  396          0        -0.11                     
CISPEP   2 ASP P  281    PRO P  282          0         0.59                     
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1                      
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.004134  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.004134  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.004134        0.00000                         
(ATOM LINES ARE NOT SHOWN.)
END                                                                             
DBGET integrated database retrieval system