KEGG   Clostridioides difficile 630: CDIF630_00574
Entry
CDIF630_00574     CDS       T03885                                 

Gene name
oraE
Definition
(GenBank) D-ornithine aminomutase, beta subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
pdc  Clostridioides difficile 630
Pathway
pdc00472  D-Arginine and D-ornithine metabolism
pdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CDIF630_00574 (oraE)
Enzymes [BR:pdc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CDIF630_00574 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AJP10141
UniProt: Q188N7
Position
534629..536833
AA seq 734 aa
MLKENKKLDIDYILKDLDKYKPKRRGWVWREHLENLEMGPFKYKDCTKPLKKSVGLPSSK
YFNNIDPQPSPVITTEIASGRFEDDIRRMRMAAHHGADHLMVIRTAGQSHFDGLIEGTPQ
GIGGVPITRKQVRAQRKALDFIEEEVGRPINYHSYVSGVAGPEVAVMFAEEGVNGAHQDP
QYNVLYRNINMVRSFVDACEAKKIMAFANIAQIDGAHNANATAREAWKVMPELMVQHALN
SIFSEKIGIDKSNICLSTVPPTAPPAPCLKIDLPYAVALRELFSDYKMRAQMNTKYMESS
TREATVTHVLNLLTSVLTRADIQSTITPDEGRNVPWHIYNIEACDTAKQALVGMDGLMDM
IELKDVGELRDKARELKERAVLYMEEISEVGGYFESVEQGFFVDSGNYPERNGDGISRKI
KGGVGEGTVYEREEDYLAPVTAHFGYNNVAQYDENAIDNPSMLIDGCTFENPDKIIYIDE
LDDFDNVENRLKESYEYRNGTKIKPEMEWCADGIVMITMMLPTDKRTAEFAALEFVKKMN
LQEIEVISREVMHESEGTRIEVKGRVPFDIDLNNLVIPEEPKVLTDEEIRADIEEKPMKI
VSATVGEDEHSVGLREIIDIKHGGIEKYGIECHYLGTSVPVEKLVDAAIELNADAILAST
IISHDDIHYKNMKKLHDYCVEKGIRDKVMIACGGTQVTPEIAVEQGIDAGFGRNSKGIHV
ATFLVEKRREMSNK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgttaaaggaaaataaaaaattggatatagactatatattaaaagatttggataaatat
aaaccaaaacgaagaggttgggtttggagagaacacttggaaaatcttgaaatgggacct
tttaaatataaagactgtacaaaacctttaaagaagagtgtagggctaccatcatctaag
tatttcaataatatagaccctcaaccaagtccagttattactactgaaatagcttctggt
agatttgaggatgatataagaagaatgagaatggcagctcatcatggagctgaccatcta
atggttatcagaactgctggacaatcacattttgatgggcttatagaaggaactccacaa
ggtataggtggagttccaataacaagaaaacaagtaagagctcaaaggaaggctcttgat
tttatagaagaagaagttggtagacctattaattaccattcatatgtaagtggtgttgct
ggtcctgaagtagcagtaatgtttgctgaggaaggagtcaatggagcacatcaagaccca
caatataatgttctgtataggaatataaacatggtaaggtcttttgtagatgcttgtgag
gcaaagaaaataatggcttttgccaatatagctcaaattgatggagcacataatgctaat
gctactgctagagaagcatggaaggtaatgcctgaacttatggttcaacacgctttaaac
tctatattctcagaaaaaataggtatagataaaagtaatatatgcttatcaacagttcca
ccaacagcacctccagcaccatgtttaaaaatagacttaccttacgctgttgcacttaga
gagttatttagtgattataagatgagagctcaaatgaatactaaatatatggaatcatca
actagagaagcaacagttactcatgtattaaacttattaacatcagtattaactagagct
gacatacaatcaactataacacctgatgaaggtagaaatgtaccttggcatatatacaat
atagaagcatgtgatacagcaaagcaagctttagttggtatggatgggcttatggatatg
atagaacttaaagatgtcggtgaattaagagacaaagcaagagaacttaaagaaagagct
gtattatatatggaagaaatatctgaagttggtggatattttgaatctgtggaacaagga
ttttttgttgattctggaaattatccagaaagaaatggtgatggaatatctagaaaaata
aaaggtggagttggtgaaggtactgtttatgaaagagaagaagattatttagcacctgta
actgctcactttggatacaataatgtagctcaatatgatgaaaatgctatagataatcca
tcaatgttaatagatggatgtacatttgaaaatccagacaaaataatatatattgatgag
cttgacgattttgataatgtagaaaatagactaaaagaatcatatgagtacagaaatgga
actaaaattaagcctgaaatggaatggtgtgcagatggaattgtaatgataacaatgatg
cttcctactgataaaagaacagcagagtttgcagctttggaatttgtcaaaaaaatgaac
ttacaagaaattgaggtcataagtagagaagttatgcatgaatctgaagggactagaata
gaagtgaaaggaagagttccgtttgatatagatttaaacaatttagtaataccagaagaa
cctaaggtactaactgatgaagaaataagagcagatatagaagaaaaacctatgaaaata
gtttcagctacggttggagaagatgaacattcagttggtttaagagaaataatagatata
aaacatggaggtattgaaaaatatggcatagaatgccactatctagggacttctgtacct
gtagaaaaattggtagatgcagcgattgaactgaatgcagatgcaatacttgcatctaca
ataataagtcatgatgatattcactataaaaacatgaaaaaattacacgattattgtgta
gaaaaaggtataagagataaagtaatgattgcgtgtggaggaacacaagtaacacctgaa
atagctgttgaacaaggcatagatgctggatttggaagaaacagcaaaggcatacatgta
gccactttcttagttgaaaaaagaagagaaatgagtaataaataa

DBGET integrated database retrieval system