KEGG   Clostridioides difficile 630: CDIF630_00843Help
Entry
CDIF630_00843     CDS       T03885                                 

Gene name
acsE
Definition
(GenBank) 5-methyltetrahydrofolate:corrinoid / iron-sulfur protein co-methyltransferase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
pdc  Clostridioides difficile 630
Pathway
pdc01100  Metabolic pathways
pdc01120  Microbial metabolism in diverse environments
pdc01200  Carbon metabolism
Brite
Enzymes [BR:pdc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     CDIF630_00843 (acsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AJP10405
UniProt: Q189S6
Position
873840..874646
Genome map
AA seq 268 aa AA seqDB search
MEKFMIIGERIHCISPSIRKALAERDPAPILKRAKEQLEAGAHYIDFNIGPAERDGEEIM
TWGIKLLQSEFNNVPIALDTANKKAIEAGLKVYDRTNAKPIINSADAGSRFDLIDIAAEY
EAMVIGLCAKEGIPRDNDERMAYCQEILEKGLMLGMEPTDILFDPLCLVIKGMQEKQVEV
LEAIKMMTEMGLLTTGGLSNVSNGCPKHVRPVLDSAFLAMAMANGFSSAIMNPCDPELMK
TVKSCDIINGASLYADSFLELNEGGFAF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttatgattataggtgagagaatacattgtatatcaccttcaataagaaaa
gcattagcagaaagagacccagctccaatcttaaaaagagcaaaagagcaattagaagca
ggagcacactatatagattttaatataggacctgccgaaagagatggcgaagaaataatg
acatggggaatcaaattacttcaatctgagttcaacaatgttcctatagcattagataca
gctaataaaaaagctatcgaagctggacttaaagtttatgatagaactaatgcaaaacca
ataataaactctgctgatgctggctcaagatttgatttaatagatatagcagctgaatac
gaagcaatggttataggtttatgtgcaaaagaaggtattccaagagataatgatgagcgt
atggcttactgccaagaaatattagaaaaaggcttaatgttaggaatggagccaactgat
atactatttgacccattatgcttagttataaaaggtatgcaagaaaaacaagtagaagtt
ttagaagctataaaaatgatgactgagatgggacttttaactacaggaggattatctaac
gtatctaatggatgtcctaagcatgttagacctgttttagatagtgcattcttagcaatg
gcaatggctaatggatttagttcagctataatgaatccatgtgacccagaattaatgaaa
actgtaaaatcttgtgacataatcaacggggcatctttatatgcagactctttcttagag
ttaaatgaaggtggatttgctttctag

DBGET integrated database retrieval system