KEGG   Clostridioides difficile 630: CDIF630_01199Help
Entry
CDIF630_01199     CDS       T03885                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pdc  Clostridioides difficile 630
Pathway
pdc00071  Fatty acid degradation
pdc00072  Synthesis and degradation of ketone bodies
pdc00280  Valine, leucine and isoleucine degradation
pdc00310  Lysine degradation
pdc00362  Benzoate degradation
pdc00380  Tryptophan metabolism
pdc00620  Pyruvate metabolism
pdc00630  Glyoxylate and dicarboxylate metabolism
pdc00640  Propanoate metabolism
pdc00650  Butanoate metabolism
pdc00900  Terpenoid backbone biosynthesis
pdc01100  Metabolic pathways
pdc01110  Biosynthesis of secondary metabolites
pdc01120  Microbial metabolism in diverse environments
pdc01130  Biosynthesis of antibiotics
pdc01200  Carbon metabolism
pdc01212  Fatty acid metabolism
pdc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDIF630_01199 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CDIF630_01199 (thlA1)
   00640 Propanoate metabolism
    CDIF630_01199 (thlA1)
   00650 Butanoate metabolism
    CDIF630_01199 (thlA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDIF630_01199 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CDIF630_01199 (thlA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDIF630_01199 (thlA1)
   00310 Lysine degradation
    CDIF630_01199 (thlA1)
   00380 Tryptophan metabolism
    CDIF630_01199 (thlA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDIF630_01199 (thlA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDIF630_01199 (thlA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDIF630_01199 (thlA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdc04147]
    CDIF630_01199 (thlA1)
Enzymes [BR:pdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDIF630_01199 (thlA1)
Exosome [BR:pdc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDIF630_01199 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJP10745
UniProt: Q18AR0
Structure
PDB: 

Position
1236396..1237571
Genome map
AA seq 391 aa AA seqDB search
MREVVIASAARTAVGSFGGAFKSVSAVELGVTAAKEAIKRANITPDMIDESLLGGVLTAG
LGQNIARQIALGAGIPVEKPAMTINIVCGSGLRSVSMASQLIALGDADIMLVGGAENMSM
SPYLVPSARYGARMGDAAFVDSMIKDGLSDIFNNYHMGITAENIAEQWNITREEQDELAL
ASQNKAEKAQAEGKFDEEIVPVVIKGRKGDTVVDKDEYIKPGTTMEKLAKLRPAFKKDGT
VTAGNASGINDGAAMLVVMAKEKAEELGIEPLATIVSYGTAGVDPKIMGYGPVPATKKAL
EAANMTIEDIDLVEANEAFAAQSVAVIRDLNIDMNKVNVNGGAIAIGHPIGCSGARILTT
LLYEMKRRDAKTGLATLCIGGGMGTTLIVKR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagtaattgccagtgcagctagaacagcagtaggaagttttggaggagca
tttaaatcagtttcagcggtagagttaggggtaacagcagctaaagaagctataaaaaga
gctaacataactccagatatgatagatgaatctcttttagggggagtacttacagcaggt
cttggacaaaatatagcaagacaaatagcattaggagcaggaataccagtagaaaaacca
gctatgactataaatatagtttgtggttctggattaagatctgtttcaatggcatctcaa
cttatagcattaggtgatgctgatataatgttagttggtggagctgaaaacatgagtatg
tctccttatttagtaccaagtgcgagatatggtgcaagaatgggtgatgctgcttttgtt
gattcaatgataaaagatggattatcagacatatttaataactatcacatgggtattact
gctgaaaacatagcagagcaatggaatataactagagaagaacaagatgaattagctctt
gcaagtcaaaataaagctgaaaaagctcaagctgaaggaaaatttgatgaagaaatagtt
cctgttgttataaaaggaagaaaaggtgacactgtagtagataaagatgaatatattaag
cctggcactacaatggagaaacttgctaagttaagacctgcatttaaaaaagatggaaca
gttactgctggtaatgcatcaggaataaatgatggtgctgctatgctagtagtaatggct
aaagaaaaagctgaagaactaggaatagagcctcttgcaactatagtttcttatggaaca
gctggtgttgaccctaaaataatgggatatggaccagttccagcaactaaaaaagcttta
gaagctgctaatatgactattgaagatatagatttagttgaagctaatgaggcatttgct
gcccaatctgtagctgtaataagagacttaaatatagatatgaataaagttaatgttaat
ggtggagcaatagctataggacatccaataggatgctcaggagcaagaatacttactaca
cttttatatgaaatgaagagaagagatgctaaaactggtcttgctacactttgtataggt
ggtggaatgggaactactttaatagttaagagatag

DBGET integrated database retrieval system