KEGG   Clostridioides difficile 630: CDIF630_01249Help
Entry
CDIF630_01249     CDS       T03885                                 

Definition
(GenBank) putative conjugative transposon protein
Organism
pdc  Clostridioides difficile 630
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TTRAP
Motif
Other DBs
NCBI-ProteinID: AJP10794
UniProt: Q18AW3
Structure
PDB: 

Position
complement(1280690..1280896)
Genome map
AA seq 68 aa AA seqDB search
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAEL
AIFAADEV
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgattagactgaccattgaagaaacaaacctgttgagcatttacaatgagggcggtaag
cgcgggcttatggagaacatcaacgctgcgctgccgtttatggacgaggatatgcgggaa
ctggcgaagcgcacccttgcgaaaattgcacctctgacagaaaatgagtatgcggagctt
gccattttcgccgctgatgaggtatga

DBGET integrated database retrieval system