KEGG   Clostridioides difficile 630: CDIF630_02850Help
Entry
CDIF630_02850     CDS       T03885                                 

Definition
(GenBank) putative pseudouridylate synthase, RluC / RluD family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pdc  Clostridioides difficile 630
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdc03009]
    CDIF630_02850
Enzymes [BR:pdc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CDIF630_02850
Ribosome biogenesis [BR:pdc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CDIF630_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 HTH_3
Motif
Other DBs
NCBI-ProteinID: AJP12345
UniProt: Q182T6
Position
complement(2989106..2990017)
Genome map
AA seq 303 aa AA seqDB search
MDEVKEFLVLEEEEEVRLDIYLAEQLGDMSRSYIQKIIKDGKVKVNNKVEKARYLVKEED
NIVIEIPEPKVLEVLPQDIPIDIVYEDDDVLIINKPQDMVVHPAPGNYENTLVNGILYHC
KDKLSSINGVIRPGIVHRIDKDTSGLLMIAKNNYAHNFLAEQLKEHTITREYEFICYGVV
KEDKITVDKPIGRNPKDRLKMAVVKDGKNAITHFEVVERFDKFTHMRARLETGRTHQIRV
HALSINHPLLGDYVYGPKETKFKLKGQTLHAKKLGFIHPTTKEYIEFNSELPEYFKEVIK
KIK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtaaaagagtttttagtacttgaagaggaagaagaagttagacttgatatt
tatctagcagaacaattaggtgatatgtcaagaagttatatacaaaaaattataaaagat
ggaaaagtaaaggttaataataaagtagaaaaagctagatatctggttaaagaggaagat
aatattgttatagagataccagaacctaaagtattagaagttttacctcaagatattcca
atagatattgtatatgaagatgatgatgtcttaataataaataaacctcaggatatggtt
gtccatcctgctcctggaaactatgaaaatacgttagtaaacgggattttatatcattgt
aaagataagttgtcatcaataaatggagttattagacctggtatagttcatagaatagac
aaagatacttctggtcttcttatgatagctaagaacaattatgcacataattttctagca
gaacagttaaaggaacatactataactagggagtatgaatttatatgctatggtgtggtt
aaagaagataaaataactgttgataaacctatagggagaaatcctaaggatagattaaaa
atggctgtagtaaaagatggaaaaaatgcaatcactcactttgaagttgtagaaagattt
gataagtttacacatatgagagctaggcttgaaactggtagaactcatcaaataagagtt
catgctttgtctataaatcacccacttttaggtgattatgtatatggtccaaaagaaact
aaatttaaattaaaaggacaaactttgcacgctaagaagttgggatttatacatcctact
actaaggaatatatcgaatttaattcagaattacctgagtattttaaggaagttattaaa
aagataaaataa

DBGET integrated database retrieval system