KEGG   Clostridioides difficile 630: CDIF630_03289Help
Entry
CDIF630_03289     CDS       T03885                                 

Definition
(GenBank) putative (2R)-sulfolactate permease
Organism
pdc  Clostridioides difficile 630
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdgT
Motif
Other DBs
NCBI-ProteinID: AJP12768
UniProt: Q184J5
Position
complement(3473337..3474311)
Genome map
AA seq 324 aa AA seqDB search
MIMDFIKKIPAGMMIVPMFIAAFINTFCPDIVQIGSFTTAVFSSVGSATIIGVQLVCLGT
QLQFREMPKVLKRGGILLGSKFAIGALIGILIGKLFGMDGVLGLTTLAVISAVTNSNGSI
YLSLMTSYGDETDCATMSLLTLNDGPFFTLIALGTSGLANVPLLSLLAAIVPILVGMIIG
NFDKKMKEFLEPGCNLLVPFVGFALGSSINLASILKGGLSGVLLGLISVFVGGIFIVFCD
KFIGKRPGYAGWAVATTAGNAIAVPAAVALVDPSWQPYVATATTQVAAAVVVTAILVPLI
TSWWAKKYGCPKFPKQNEDGTITA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgataatggattttattaaaaaaattcctgcaggtatgatgatagtgccaatgtttata
gcagctttcattaataccttttgcccagatattgtacaaataggttcgtttacgacagca
gtattttcaagtgttgggtctgcaactataattggggttcaactggtatgcttgggaact
cagcttcaatttagagaaatgccaaaagttttaaagagaggtggtatacttcttggttct
aaatttgctataggtgctttgataggtatacttataggaaagctatttggaatggatggt
gtccttggtcttacaacattggctgttataagtgcagttacaaatagtaatggtagtata
tatctttcattgatgacttcatatggagatgaaacagattgtgcaactatgagtttactt
actttaaatgatggaccattttttacattaatagctcttgggacttcaggtcttgcaaat
gtaccattgttgtcattattggctgcaatagtgccaatacttgttggtatgataatagga
aattttgacaaaaaaatgaaagagtttttagagccagggtgtaatttactcgtacctttt
gtagggtttgcacttggtagtagcataaatcttgcaagtatactaaaaggaggtttatca
ggagtattacttggattaatatctgtatttgtaggaggtatatttatagtattctgtgat
aaatttataggaaaacgtccaggatatgcaggatgggctgtagctacaactgctggaaat
gcaattgctgtacctgctgctgttgcattagttgacccatcatggcaaccatatgttgca
acagctacaacacaagtggcagccgcagtagttgtcactgcaatattagtacctcttata
actagttggtgggctaagaagtatggatgtcctaagttcccaaaacaaaatgaggatggt
acaataacagcttaa

DBGET integrated database retrieval system