KEGG   Clostridioides difficile 630: CDIF630_03700Help
Entry
CDIF630_03700     CDS       T03885                                 

Gene name
pfkA
Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pdc  Clostridioides difficile 630
Pathway
pdc00010  Glycolysis / Gluconeogenesis
pdc00030  Pentose phosphate pathway
pdc00051  Fructose and mannose metabolism
pdc00052  Galactose metabolism
pdc00680  Methane metabolism
pdc01100  Metabolic pathways
pdc01110  Biosynthesis of secondary metabolites
pdc01120  Microbial metabolism in diverse environments
pdc01130  Biosynthesis of antibiotics
pdc01200  Carbon metabolism
pdc01230  Biosynthesis of amino acids
pdc03018  RNA degradation
Module
pdc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pdc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDIF630_03700 (pfkA)
   00030 Pentose phosphate pathway
    CDIF630_03700 (pfkA)
   00051 Fructose and mannose metabolism
    CDIF630_03700 (pfkA)
   00052 Galactose metabolism
    CDIF630_03700 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CDIF630_03700 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CDIF630_03700 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdc01009]
    CDIF630_03700 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdc03019]
    CDIF630_03700 (pfkA)
Enzymes [BR:pdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDIF630_03700 (pfkA)
Protein phosphatases and associated proteins [BR:pdc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CDIF630_03700 (pfkA)
Messenger RNA biogenesis [BR:pdc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CDIF630_03700 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AJP13169
UniProt: Q180P4
Position
complement(3955367..3956326)
Genome map
AA seq 319 aa AA seqDB search
MKTIGLLTSGGDAPGMNAAIRAVVRSAIYYGCKVYGINRGYKGLLEEDLTEMNLSSVGDI
IHRGGTILKSSRCEEFKTEEGRLKAVKILKKYKIDCLVVIGGDGSFAGAQKLSDLGFPAI
GIPGTIDNDLAYTDYTIGFDTAMNTIIDAIGKIRDTSSSHERVNIVEVMGRHCGDLALYA
GLAGGAETIIVPEVEITVDEVALRLKTTQKRGKRHSIIVLAEGVGSASDLEKELKKESGA
DLRVTVLGHVQRGGSPTVSDRILASRLGVRAVELLLDGKSARVVGIKENKIIDLEISEAL
AQKKVFDKEAYEMAKILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggattactaacaagtggaggagatgctccaggaatgaatgctgcgatt
agagcggttgtaagatcagcaatatattatggatgcaaagtatatggaatcaatagagga
tataagggattactagaagaagatttaactgaaatgaacttatcttctgttggagatatt
atacacaggggaggaactatattaaaatcttccagatgtgaagaatttaaaacagaagaa
ggtagattaaaagcagtaaaaattcttaaaaagtataaaattgattgcttagttgtaatt
ggtggagatggttcatttgcaggagctcaaaaacttagtgacttaggattcccagctata
ggcataccaggaactatagataacgatttagcatatacagattatactataggatttgat
actgcaatgaatactattatagatgctataggtaagataagagatacatcatcatctcat
gaaagagttaacatagtagaagttatgggaagacactgtggagatttagccttatatgca
ggtcttgcaggaggagcggaaactataatagtaccagaagtagaaattacagtagatgaa
gttgctctaagattaaagactactcaaaaaagaggtaagagacatagtataatcgtttta
gcagaaggagtcggaagtgctagtgatttagaaaaggaacttaaaaaagagtcaggagca
gatttaagagtcactgtattggggcatgtccaaagaggaggaagcccaactgtatctgat
agaatactagcaagtagacttggagtaagagcagtagaattattattagatggaaaatca
gctagagttgtaggaataaaagaaaacaaaataattgatttagaaataagtgaagcttta
gctcaaaagaaagtatttgataaagaagcttatgagatggcaaaaatattatctatataa

DBGET integrated database retrieval system