KEGG   Paracoccus denitrificans: Pden_0137
Entry
Pden_0137         CDS       T00440                                 

Definition
(GenBank) Lytic transglycosylase, catalytic
Organism
pde  Paracoccus denitrificans
SSDB
Motif
Pfam: SLT SLT_2 Transglycosylas
Other DBs
NCBI-ProteinID: ABL68254
UniProt: A1AYB0
Position
1:122855..123550
AA seq 231 aa
MPVSVLRHTDGRAYAARGIAILLLSGLTIATLPAAGLLAQTVQPVVRESRDPFASHVAEA
SLRFGIPAHWIRAVRHVESAGNPQAVSPKGAMGLMQIMPKTWAALRARHALGDDPFDPRD
NIFAGAAYLREMHDRYGTIAGMLAAYNAGPGRYDEHLISGRLLPAETRAYVAALAPLMGG
VTLPGSPPAVAPPRDWREAPLFTGSMTGSPDAERVQPGGLFLRRSDAGAVQ
NT seq 696 nt   +upstreamnt  +downstreamnt
atgccggtatccgtccttcgccatactgacgggcgggcttacgccgcccgcggcatcgcc
attcttcttctttccggcctgacaatcgccaccctcccggctgccggcctgctggcgcag
accgtgcagccagtcgtgcgagaatcccgcgatcccttcgcgtcccatgtcgcggaagcc
tcgctgcgcttcggcattccggcgcactggatccgcgccgtgcgccatgtcgaaagcgcc
ggcaatccgcaggccgtctcgcccaagggcgccatgggcctgatgcagatcatgccgaag
acatgggcggcgctgcgcgcccgccatgctctcggcgacgatccgttcgacccgcgcgac
aacattttcgccggcgccgcctatctgcgcgagatgcacgaccgctacggcaccatcgct
ggcatgctggcagcctacaatgccgggccgggacgctacgacgagcacctgatctcgggc
cggctcctgccggccgagacccgcgcctatgtcgccgcgctcgcgccgctgatgggcggc
gtgacgcttcctggcagtcctcctgctgtcgcgcctccgcgcgattggcgcgaagcaccg
ctcttcaccggcagcatgaccggcagcccggatgcggaacgagtgcagcccggcggtctg
ttcctgcgccggtccgacgcgggagcagtgcaatga

DBGET integrated database retrieval system