KEGG   Paracoccus denitrificans: Pden_0152
Entry
Pden_0152         CDS       T00440                                 

Definition
(GenBank) conjugal transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
pde  Paracoccus denitrificans
Pathway
pde02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pde00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Pden_0152
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pde02044]
    Pden_0152
Secretion system [BR:pde02044]
 Type IV secretion system
  Trb secretion system protein
   Pden_0152
SSDB
Motif
Pfam: LXG DUF948 ALIX_LYPXL_bnd DUF848 Mod_r PLU-1 LIN37
Other DBs
NCBI-ProteinID: ABL68269
UniProt: A1AYC5
Position
1:complement(135101..135901)
AA seq 266 aa
MTRSTTVTMRRHIRAIASTTALALALATPLALAPLLTTPAHAFFGGFGRIVYDPTNHAEN
LLTAARSLEQINNQIASLQNEAQMLINQARDLASLPHSSLQQLQQNVTRTQQLLDEAQNI
AFEVQEVDQAFEREYGTPDLSTSEQQLLADARTRWSNTMGGLQDAMRVQSGVTNNIEAQR
AEMAALVEQSQNADGALQASQAGNQLLALQSQQLSDLTALLAATGRAEALSEAERSAAAE
QGRIQRERFLTPGAGYQPGNARMFND
NT seq 801 nt   +upstreamnt  +downstreamnt
atgacgcgcagcacaacagtcaccatgcgtcgccacattcgcgccattgccagcacgacc
gcactggcccttgcgctggcgacaccgctggcactggcccctctcctgacaaccccggcg
catgctttcttcggtggcttcggccgcatcgtctacgacccgaccaaccatgccgagaac
ctgctgaccgccgccaggtcgctggagcagatcaacaaccagatcgcctcgctgcagaac
gaggcgcagatgctgatcaaccaggcccgcgatctcgccagcctgccgcatagctcgctg
cagcaattgcagcagaacgtcacccgcacccagcagttgctcgacgaggcccagaacatc
gccttcgaggtgcaggaggtcgatcaggctttcgagcgggaatacggcacgccggatctc
tcgacatccgagcagcaactgctggccgatgcccggacgcgctggagcaacaccatgggc
gggcttcaggacgccatgcgcgtccagtccggcgtcaccaacaacatcgaggcgcagcgg
gccgagatggccgcgctggtcgagcagagccagaatgctgacggcgccttgcaggccagc
caggccggcaaccagttgctggccctgcaatcgcagcaactgtccgacctcaccgcgctc
ctcgccgccaccggccgggccgaggcactgagcgaggccgagcgctcggcggcggccgaa
cagggccgcatccagcgcgaacggtttctgacacccggcgccggctaccagcccggcaat
gcccggatgttcaacgactga

DBGET integrated database retrieval system