KEGG   Paracoccus denitrificans: Pden_0568Help
Entry
Pden_0568         CDS       T00440                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pde  Paracoccus denitrificans
Pathway
pde00020  Citrate cycle (TCA cycle)
pde00190  Oxidative phosphorylation
pde00650  Butanoate metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
pde01200  Carbon metabolism
Module
pde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pde_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pden_0568
   00650 Butanoate metabolism
    Pden_0568
  Energy metabolism
   00190 Oxidative phosphorylation
    Pden_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Claudin_2 Glyco_hydro_125 Ribonuc_2-5A
Motif
Other DBs
NCBI-ProteinID: ABL68680
UniProt: A1AZI6
Position
1:541566..541955
Genome map
AA seq 129 aa AA seqDB search
MRYITPRKAAEGLGSAHEGTQHHWAMTVSAVALTVLTPLFMIVVARAIGLSQEQLLAYFG
RPFPALITALFVIVGMVHFIKGTRIMIDDYFQGGTRKAAIIFSVIFGWAVIAAAVYALAR
MGLGAIVVL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcaccccccgcaaagccgccgaaggcctgggctcggcccacgaaggcacc
cagcatcactgggccatgaccgtctcggccgtggcgctgaccgtgctgacgccgctgttc
atgatcgtcgtggcccgcgccatcggcctgtcgcaggaacagttgctggcctatttcggc
cgtcccttcccggcgctcatcaccgctctgttcgtgatcgtgggcatggtccacttcatc
aagggcacgcggatcatgatcgacgactatttccagggtggcacgcgcaaggcggccatc
atcttttccgtcatcttcggctgggcggtcatcgccgcagccgtctatgcgctggcccgg
atgggccttggcgcgatcgtcgtcctctga

DBGET integrated database retrieval system