KEGG   Paracoccus denitrificans: Pden_0634Help
Entry
Pden_0634         CDS       T00440                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pde  Paracoccus denitrificans
Brite
KEGG Orthology (KO) [BR:pde00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Pden_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABL68746
UniProt: A1AZQ2
Position
1:complement(610511..611935)
Genome map
AA seq 474 aa AA seqDB search
MRREPREYRTLDKDLSRVTNAERAGLHSARPLMRLGLALIFIAAASYVGTGFLADQPALG
ILAASIAVAAYLALSIGGNDVANALGPAVGAGAIGMTAGLLLMAAMEVLGAVIAGSAVTA
TLTEGLVGSTLGEGEATARMMLAALLAAGSWISLATWLGAPVSTTHSVVGAIAGAGMATF
GAGAVNWPAMAMIAFGWIASPLVSGLIAAGLMVLLRMLVLDREDRIAAARTWMPVIVGLA
SAMLAGVAELAWHGSGLAANAVLVLVCGGLGWLYTRRRIDRQTRGMGGGRLAMKQLLAVP
LIAAALVMGFAHGANDVSNVAAPLTIILDSLSAGGDDDLRARLVLLLGGLGIALGILLFG
RRLVHMVGSRITRLNASRALCVSLATAATVLWASLLGLPVSTTHVAVGGVFGVGFYREWR
DRRLAASHAPLPAEERRRRHLVRRSYMRMILGAWLVTVPAAATLAAALVRIVGL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcgaaccccgcgaataccgcacgctggacaaggatctgagccgcgtcaccaat
gccgagcgcgcagggctgcattctgcgcgcccgctcatgcggctgggactggcgctgatc
ttcatcgccgccgccagctatgttggcaccggctttctggcggatcagcccgcccttggc
atcctggcggccagcatcgcggtcgcggcctatctggcgctgtcgatcggcggcaacgac
gtggcgaacgcgctggggccggcagtgggcgcgggcgccatcggcatgaccgccggcctg
ctgctgatggccgcgatggaggtgctgggcgcggtcatcgccggcagcgcggtaaccgcc
acgctgaccgaggggctggtcggcagcacgctgggcgagggcgaggcgacggcgcggatg
atgctggccgcgctgctggcggcgggcagctggatcagccttgccacatggctcggcgcg
ccggtcagcaccacgcattccgtggtcggcgccatcgccggcgcagggatggcgaccttt
ggcgccggcgcggtgaactggccggccatggcgatgatcgcctttggctggatcgcctcg
ccactggtctccggcctgatcgcggccgggctgatggtgctgctgcgcatgctcgtgctg
gatcgcgaggatcgcatcgccgccgcccgcacctggatgccggtgatcgtcgggctggcc
tcggccatgctggcgggggtggcggaactggcctggcacggctcggggctggcggcgaat
gcggtgctggtgctggtctgcggcgggctcggctggctttatacccggcggcgcatcgac
cgccagacgcgcggcatgggtggcgggcgtctggcgatgaagcagttgctggcggtgccg
ctgattgccgcggcgctggtcatgggctttgcccatggcgccaacgacgtctcgaacgtg
gcggcgcccctgaccatcatcctcgacagtctgtcggcggggggcgacgacgacctgcgc
gcccggctggtgctgcttctgggcggccttggcatcgcgctgggtatcctgctgttcggg
cggcggctggtgcatatggtcggcagccgcatcacccggctgaacgcctcgcgcgcgctt
tgcgtctcgctggcgacggcggcgacggtgctgtgggcctcgctgctcgggctgccggtc
tcgaccacgcatgtcgcggtgggcggcgtgttcggcgtcggcttctatcgcgaatggcgc
gaccgccggctggcggccagccacgcccccctgcccgccgaggaacgccgccgccgccat
ctggtgcgccgatcctacatgcgcatgatcctgggcgcctggctggtgactgtgcccgcc
gccgccacgctggccgcggcgctggtccgaatcgtcgggctctag

DBGET integrated database retrieval system