KEGG   Paracoccus denitrificans: Pden_1111Help
Entry
Pden_1111         CDS       T00440                                 

Definition
(GenBank) NCS1 nucleoside transporter family
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
pde  Paracoccus denitrificans
Brite
KEGG Orthology (KO) [BR:pde00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Pden_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur DUF5090
Motif
Other DBs
NCBI-ProteinID: ABL69219
UniProt: A1B125
Position
1:complement(1086592..1088076)
Genome map
AA seq 494 aa AA seqDB search
MTQVEATAYEMLSRSGLPADDLDPDLYNEDQLPTTVAERTWTWVSISALWVGMVVCIPTY
LLASYLIGAGMDWKQAVITILLANAIVLIPMVLIGHAGAKYGIPFPVLLRSSFGPMGARI
PAVARGIVACGWFGIQTWVGGSAIYVILNTLSGGLFASEALPILGINLTEFLCFLAFWGL
HLYFIKHGTESIRWLETWSAPFLIAMGLALLAWAWVKAGGFGPMLSAPSQFAPGQPKEGQ
FWSVFWPSLTGMIGYWATLALNIPDFTRHARSQKDQFLGQLIGLPLPMALFAFISAAVTS
ATIVIYGEAIWDPIQLTERMGGVGIIVALVALIVATLTTNLAANVVAPAHGFSNLAPSRI
NLRRGGYITAAIGLAMFPWLLINHIVDLLVAFSALLGPIAGVMLADYYLLRGTRLSVPDL
FRRGGIYEGSGGNNWAGIGALILGILPNILGFMVAIGLSSSAPALFMSIYTYAWFVGLFV
AGIAYLVLSKLLNR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagtcgaggcaaccgcctatgaaatgctgtcccggtcgggcctgccggccgat
gacctggacccggacctctacaacgaggaccagttgcccacaactgtcgcggaacggacc
tggacctgggtctcgatctcggcgctttgggtcgggatggtcgtctgcatcccgacctac
ctgctggcctcgtatctgatcggggcggggatggactggaagcaggcggtgatcaccatc
cttctggccaatgccatcgtgctgatcccgatggtgctgatcggccatgccggggccaaa
tacggcattccgttcccggtgctcttgcgttcctccttcgggccgatgggcgcgcgcatt
cccgccgtggcgcgcggcatcgtcgcctgcggctggttcgggatccagacctgggtgggc
ggctcggccatctatgtcatcctgaacacgctgtcgggcgggcttttcgcctccgaggcg
ctgccgatcctgggcatcaacctgaccgagttcctgtgcttcctggccttctgggggctg
catctctatttcatcaagcacggaacggaatcgatccgctggctcgagacctggtcggca
cccttcctcatcgccatgggcctggcgctgctggcctgggcctgggtcaaggccggaggc
ttcggcccgatgctgtccgcacccagccagttcgcccccggccagccgaaagaggggcag
ttctggtccgtcttctggcccagcctgaccggcatgatcggctattgggcgactctggcg
ctgaacattcccgacttcacccgccatgcccgcagccaaaaggaccagttcctgggccag
ttgatcggcctgccgctgccgatggcgctattcgccttcatatcggccgcggtgacctcg
gccacgatcgtcatctatggcgaggcgatctgggacccgatccagctgaccgagcggatg
ggcggcgtcggcatcatcgtcgcgctggtggcgctgatcgtggcgacgctgaccaccaac
ctcgcggccaacgtggtcgctccggcgcacggcttttcgaacctcgcgcccagcaggatc
aacctgcgtcgcgggggctacatcaccgccgcgatcgggctggccatgttcccctggctg
ctgatcaaccacatcgtcgatctgctggtggcgttctcggccctgctgggtccgatcgca
ggcgtcatgctggcggattactacctgctgcgcggcacccggctgagcgttcccgacctt
ttccgccgcggcggcatctacgagggctcgggcggcaacaactgggccgggatcggggcc
ttgatcctgggcatcctgcccaatattctgggcttcatggtggccatcggcctgtcgtcc
agcgcgccggccctgttcatgtcgatctatacctatgcctggttcgtcggcctgttcgtg
gcgggaatcgcctatctggtcctgtcgaaactcttgaaccgttga

DBGET integrated database retrieval system