KEGG   Paracoccus denitrificans: Pden_1475
Entry
Pden_1475         CDS       T00440                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
pde  Paracoccus denitrificans
Pathway
pde02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pde00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Pden_1475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pde02044]
    Pden_1475
Secretion system [BR:pde02044]
 Type IV secretion system
  Trb secretion system protein
   Pden_1475
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABL69575
UniProt: A1B231
Position
1:complement(1436499..1437620)
AA seq 373 aa
MSDTDPAATMRLRPDPPRVTRLSRRVLAGAGAVALFGIGGAMIYALQTREAGPGGGELYS
IDNRPAADGLEGLPSDYTGPVLGPALPGDLGRPILDAQERGVPVTPPPIVGPTVDPEAER
RRAEEETARLSGVFFQTASGRATTAGVGVNLPGLGGSEQPEGNRHTAFLNDQVDRQTVAS
DRIQPPASPYILQAGAVIPAALITGIRSDLPGQITAQVTENVYDSPTGSLLLIPQGTRII
GQYDDGVTFGQRRVLLVWNRLILPGGRSIVLERLPGADASGYAGLEDGVDYHWWDLMRAA
GLSTLLAIGADLATDDEDRLVEAIRDGAVDTINQAGQQIVGRQLQVAPTLTIRPGFPVRI
IVTRDLVFEPAGG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgagtgacaccgatcctgcagctacgatgcgtctgcgtcccgatccgccgcgcgtgacc
aggctgtcgcgcagggttctggccggtgccggagcggtcgcgctgttcggcatcgggggt
gctatgatctatgcgctccagacccgtgaggccgggccgggaggcggagaactctattcc
atcgacaaccgaccggccgcggacggcctggaagggttgccctccgactataccggaccg
gttctgggacccgcactgcccggtgacctcgggcggccgatcctcgacgcgcaggagcgg
ggagtgcccgtgaccccgccgccgattgtcggcccgaccgtcgatccggaagcggagcgc
cgcagggcagaggaggaaaccgcgcgtctgagcggtgtcttcttccagacggcatctggc
agggcaacgacggccggggtcggcgtgaaccttccgggcctggggggctccgagcaacct
gagggaaaccggcatacggctttcctcaacgatcaggtggatcggcagaccgtcgcatcg
gatcgcattcagccgccagcctcgccgtacatccttcaggcgggagctgtgattccggcc
gcgctcatcaccggcattcgctccgatctcccggggcagatcaccgcgcaggtcaccgag
aatgtctatgacagcccgaccggatcactgctattgatcccacaaggaacccgcatcatc
ggccaatacgatgacggagtgacgttcggccaacgccgcgtgctgttggtctggaaccgc
ttgatccttcccggtggccgatccatcgttctcgaacgtctgccaggcgcggatgcgagc
ggctatgccggcctcgaagatggcgttgattaccattggtgggatctgatgcgcgcggcg
ggtctgtccacgctgctcgcgatcggcgcggacctcgccaccgatgatgaagaccgtctg
gtcgaggcgatccgcgatggcgcggtggatacaattaaccaggccggccagcagatcgtc
gggcgtcagttgcaggtcgcgccgacactgaccattcgcccggggttcccggtcaggatc
atcgtcacccgcgatctggtattcgaaccggcaggaggttga

DBGET integrated database retrieval system