KEGG   Paracoccus denitrificans: Pden_1699Help
Entry
Pden_1699         CDS       T00440                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pde  Paracoccus denitrificans
Pathway
pde00630  Glyoxylate and dicarboxylate metabolism
pde00710  Carbon fixation in photosynthetic organisms
pde01100  Metabolic pathways
pde01120  Microbial metabolism in diverse environments
pde01200  Carbon metabolism
Module
pde_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pde_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pden_1699
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pden_1699
Enzymes [BR:pde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Pden_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABL69796
UniProt: A1B2Q2
Position
1:1682975..1684438
Genome map
AA seq 487 aa AA seqDB search
MNEMSKSEITDKKKRYAAGVLKYAQMGYWDGDYQPKDTDILALFRITPQDGVDPIEAAAA
VAGESSTATWTVVWTDRLTACDQYRAKAYKVEPVPGQEGQYFCYVAYDLILFEEGSIANV
TASIIGNVFSFKPLLAARLEDMRFPVAYMKTFAGPPTGIVVERERLDKFGRPLLGATTKP
KLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYCMEAVNKATAVTGEVK
GHYLNITAGTMEEMYRRAELAKELGSVIVMVDLIVGWTAIQSISNWCRQNDMILHMHRAG
HGTYTRQKNHGISFRVIAKWLRMAGVDHLHCGTAVGKLEGDPLTVQGYYNTCREMVNEVD
LPRGIFFEQDWGNLKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGA
TANRVALEAMVLARNEGVDLKTEGPEVLRRAAKWCKPLEAALDVWGNITFNYTSTDTSDF
VPTASVS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgagcaaatccgaaatcaccgacaagaagaagcgttatgccgccggcgtg
ctgaaatacgcccagatgggctattgggacggcgactaccagcccaaggacaccgacatc
ctggcgctgttccgcatcaccccgcaggatggcgtggaccccatcgaggcggcggcggcc
gtggccggcgaaagctcgaccgcgacctggaccgtggtctggaccgaccggctgaccgcc
tgcgaccagtatcgcgcgaaagcctacaaggtcgagccggtgccggggcaggaaggccag
tatttctgctatgtcgcttatgacctgatcctgttcgaggaaggctcgatcgccaacgtc
accgcctcgatcatcggcaacgtgttcagcttcaagccgctgctggccgcgcggctcgag
gacatgcgctttccggtcgcctacatgaagacctttgccggcccgcccaccggcatcgtg
gtcgagcgcgagcggctggacaagttcggccgccccctgctgggcgccaccaccaagccc
aagctgggcctttccggcaagaactacggccgcgtggtctatgaagggctcaagggcggg
ctcgacttcatgaaggacgacgagaacatcaactcgcagcccttcatgcattggcgcgac
cgtttcctctattgcatggaggcggtgaacaaggccaccgccgtcaccggcgaggtcaag
ggccattacctcaacatcaccgccggcacgatggaagagatgtatcgccgcgccgaactg
gccaaggagctgggctcggtcatcgtcatggtggacctgatcgtcggctggacggcgatc
cagtcgatctcgaactggtgccggcagaacgacatgatcctgcacatgcaccgcgccggg
cacggcacctatacccggcagaagaaccacggcatcagcttccgcgtcatcgccaaatgg
ctgcgcatggcgggcgtcgaccacctgcattgcggcaccgccgtcggcaagctcgagggc
gatccgctgaccgtgcagggctattacaacacctgccgcgagatggtgaacgaggtggac
ctgccgcgcggcatcttcttcgagcaggactggggcaacctgaaaaaggtgatgccggtc
gcctcgggcggcatccatgccgggcagatgcaccagttgctggacttgttcggcgacgac
gtggtcctgcaattcggcggcggcaccatcggccacccgatgggcatccaggcgggcgcc
acggcgaaccgcgtggcgctggaggccatggtgctggcccgcaacgagggcgtggacctg
aagaccgagggccccgaagtcctgcgccgcgccgccaaatggtgcaagcctttggaggcc
gcgctggatgtctggggcaacatcaccttcaactatacctcgaccgacacctcggacttc
gttccgaccgcgtccgtcagctaa

DBGET integrated database retrieval system