KEGG   Paracoccus denitrificans: Pden_1937Help
Entry
Pden_1937         CDS       T00440                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
pde  Paracoccus denitrificans
Pathway
pde02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pden_1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABL70030
UniProt: A1B3D6
Structure
PDB: 

Position
1:1936399..1936866
Genome map
AA seq 155 aa AA seqDB search
MKISIYATLAAITLALPAAAQDGDAAKGEKEFNKCKACHMIQAPDGTDIIKGGKTGPNLY
GVVGRKIASEEGFKYGEGILEVAEKNPDLTWTEADLIEYVTDPKPWLVKMTDDKGAKTKM
TFKMGKNQADVVAFLAQNSPDAGGDGEAAAEGESN
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcagcatctatgccactctcgccgccatcaccctcgccctgcccgctgcggcc
caggatggcgacgccgccaaaggcgagaaagaattcaacaagtgcaaggcttgccacatg
atccaggcgccggacggcaccgacatcatcaagggcggcaagaccgggcccaacctttac
ggcgtcgtcggccgcaagatcgcctcggaggagggcttcaaatacggcgaaggcatcctc
gaggtcgccgaaaagaaccccgacctgacctggaccgaggccgacctgatcgaatacgtc
accgaccccaagccctggctggtcaagatgaccgacgacaagggcgccaagaccaagatg
accttcaagatgggcaagaaccaggccgacgtggtggccttcctggcccagaactcgccc
gatgcgggcggcgacggcgaggctgcggccgagggcgaatcgaactga

DBGET integrated database retrieval system