KEGG   Paracoccus denitrificans: Pden_1961Help
Entry
Pden_1961         CDS       T00440                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pde  Paracoccus denitrificans
Pathway
pde00520  Amino sugar and nucleotide sugar metabolism
pde00550  Peptidoglycan biosynthesis
pde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pden_1961
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pden_1961
Enzymes [BR:pde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Pden_1961
Peptidoglycan biosynthesis and degradation proteins [BR:pde01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Pden_1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase SoxE
Motif
Other DBs
NCBI-ProteinID: ABL70053
UniProt: A1B3F9
Position
1:complement(1963583..1964863)
Genome map
AA seq 426 aa AA seqDB search
MDQIIVRGNGPLKGEIPITGAKNACLALMPATLLTDQPLTLTNAPRLSDIRTMTALLQSL
GAEVASLQDGQVLALSSHDLTSHRADYDIVRKMRASILVLGPMLARDGHAVVSLPGGCAI
GARPVDLHLRALEAMGADLDLREGYVHAKAPSGGLRGAVIDFPLVSVGATENALMAATLA
RGTTVINNAAREPEIVDLAECLRRMGAQIEGEGTSTITVEGVQALGGATHPVVTDRIELG
TYMLAPAICGGEVECLGGRIDLVAAFCEKLDEAGIEVVETGRGLKVSRKNGRVRAVDVVT
EPFPGFPTDLQAQMMALLCTAEGTSVLEEKIFENRFMHAPELARMGARIEVHGGHATVHG
VEKLRGAPVMATDLRASVSLILAGLAAEGETIVSRVYHLDRGYEKVVRKLRGVGADIERI
KEVADG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatcattgtaagggggaacgggccgctcaagggcgagatcccgatcaccggc
gccaagaatgcctgcctggcgctgatgccggcgacgctgctgaccgaccagccgctgacg
ctgaccaatgcgccgcggctgtcggatatccgcaccatgaccgcgctgctgcaatcgctg
ggggcggaggtcgccagcctccaggacgggcaggtgctcgcgctgtcgagccatgacctg
accagccaccgggccgattacgacatcgtgcgcaagatgcgcgcctcgatcctggtgctg
gggccgatgctggcgcgcgacggccatgccgtggtctcgctgcccggcggctgcgccatc
ggcgcccggccggtggacctgcacctgcgcgcgctcgaggcgatgggggccgatctcgac
ctgcgcgagggctatgtccatgccaaggcgccttcgggtgggctcaggggcgcggtgatc
gacttcccgctggtttcggtcggcgcgaccgagaacgcgctgatggcggcgacgctggcg
cggggcacgaccgtcatcaacaatgccgcgcgcgagccagagatcgtggacctggccgaa
tgcctgcgccgcatgggcgcgcagatcgagggcgagggaacatcgaccatcaccgtcgag
ggcgtccaggcgcttggcggcgcgacgcatccggtggtgaccgaccggatcgaactgggc
acatacatgctggcccccgcgatctgcggaggcgaggtcgaatgccttggcggccggatc
gacctggtcgcggccttctgcgaaaagctcgacgaggccggcatcgaggtggtcgagacc
gggcgggggctgaaggtttcgcgcaagaacggccgcgtgcgtgcggtcgacgtggtgacc
gaacccttcccgggcttccccaccgatctccaggcgcagatgatggcgctgctttgcacc
gccgagggcacctcggtgctggaggagaagatcttcgagaaccgcttcatgcatgccccg
gaactcgcgcgcatgggcgcccggatcgaggtgcatggcggccatgctaccgtccacggc
gtcgaaaagctgcgcggtgccccggtgatggcgaccgacctgcgcgcctcggtcagcctg
atccttgccgggcttgctgccgagggcgaaaccatcgtcagccgcgtctatcacctggat
cgcggctatgaaaaggtggtgcgcaagctgcgcggcgtcggcgccgatatcgaacgcatc
aaggaggtcgccgatggctga

DBGET integrated database retrieval system