KEGG   Paracoccus denitrificans: Pden_2449Help
Entry
Pden_2449         CDS       T00440                                 

Definition
(GenBank) FHA domain containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
pde  Paracoccus denitrificans
Brite
KEGG Orthology (KO) [BR:pde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pde02044]
    Pden_2449
Secretion system [BR:pde02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Pden_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: ABL70536
UniProt: A1B4U2
Position
1:2455141..2456376
Genome map
AA seq 411 aa AA seqDB search
MTLRLTILASPVPQPQTELRLDSGRAELGREPGCDWQIDDPEMFVSRRHCIVEATAEGWT
VTDTSTGGLFLDGAAEPLGPGRSAALRDGMRLRLGDVTLGVTVETGAQAAAAPDQGIGID
PFFAPRDPAPPPPPRPLELPEPFERTTGRFAPQPPPAPPPGFDDPFMLDPLPAAPPATPP
QAGDDWSWGPAGASPPRPEPVPVMSAALPDSPPPAAPQPQPPSDAAAAFLRGAGLDPASV
EGVDIEALGRRYRMLAEGLVALLRARAEEKGSLRVARTTLGAAQVNPLKFLAMPDEQVAA
LIAPRGSGYLDPDDAIAEAFRDLADHRMRSWHGLQAALRRMIDRFSPEAIEAQLADAGLL
RALLAGGRSALLWDAYAARWAEIARAAEDRFLGEVGAEFRDAYETPDRSEP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcctcaccatccttgcaagccccgttccccagccccaaaccgaattgcgg
ctggacagcggccgggcggagctggggcgcgagccgggctgcgactggcagatcgacgac
cccgagatgttcgtctcgcgccgccattgcatcgtcgaggccacggccgagggctggacc
gtcaccgataccagcaccggcgggctgttcctcgacggggcggccgagccgctgggaccg
ggccgcagcgccgcgctgcgcgacggaatgcggctgcggctgggcgacgtcactctgggc
gtgaccgtcgagaccggggcgcaggcagcggcggcacccgaccaaggcatcgggatcgac
ccgttcttcgcgccccgcgatccggcaccgccgccgccgccgcgcccgctggaactgccc
gaacccttcgagcgcacgaccggccgtttcgccccgcaaccgccgcccgcgccgccgccg
ggcttcgacgatcccttcatgctggacccgctgcccgccgcaccgcctgcaacgccgccc
caggcgggcgacgattggagctggggaccggcgggcgcatcgccgccccggcccgaaccc
gtgcctgtcatgtcagccgctctgccggattcccctccccctgccgccccgcaaccgcag
ccgccatccgacgcggccgccgccttcctgcgcggcgccgggctggacccggcaagtgtc
gaaggtgtcgacatcgaggcgcttggccgccgctaccggatgctggccgaggggctggtc
gcattgctgcgcgcgcgggccgaggaaaagggctcgttgcgcgtcgcccgcaccacgctg
ggcgcggcacaggtcaacccgttgaaattccttgccatgcccgacgaacaggtggccgcg
ctgatcgcgccgcgcgggtcgggctatctggaccccgacgacgccatcgccgaggcgttc
cgcgaccttgccgaccaccggatgcgcagctggcacggcttgcaggccgcgctgcgccgc
atgatcgaccgcttctcgcccgaggcgatcgaggcgcagctggccgatgccgggctgctg
cgggcgctgctggcgggcgggcgctcggcgctgctttgggacgcctatgccgcccgctgg
gccgagatcgcccgcgccgccgaggaccgcttcctgggcgaggtcggcgccgaattccgc
gatgcctacgaaacccctgacaggagcgagccatga

DBGET integrated database retrieval system