KEGG   Paracoccus denitrificans: Pden_2452
Entry
Pden_2452         CDS       T00440                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pde  Paracoccus denitrificans
Pathway
pde03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pden_2452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pde02044]
    Pden_2452
Secretion system [BR:pde02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pden_2452
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: ABL70539
UniProt: A1B4U5
Position
1:2458202..2459593
AA seq 463 aa
MGGDPNDPFGLGDPGRTRIRPLGAGRPQSQPDPPGPMLPRPAWQAPPDPVAPEAAPHARR
GRAHPNPLVAAHATLLELAPELERANPPARPDALRARLQSVLVEGRDASVAAGTPLSRAD
QGAWFVAALLDDLALNTPWGGQSDWPRQPLVTQMTGEVDAGTRFFDRLDTLMRNPAGERD
LLELAWLCLCLGFRGKYRVQGGAGEGALVALRAQIARLLRDPEREAAPLAPHGAGVVAPD
TPRRFAVPLWTLWLGALGLVLAIHTGLSMHLSGKAESLFTQAAGLPPPDRAAIFRPVRQT
VEPAPELPATVIDPLLPAFEAALPAALRPAMKGRETSGLVVLVVRASDPEVFRSAKASLN
PAYQPLVEAIGRTVVANAHRIGAVAVSGHTDNVPVQRSNPFASNQGLSEARAETVAQALA
AAGVPAELISAEGRADSQPVGDNATRDGRAQNRRIEIRIEKRQ
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggcggcgatccgaacgatcccttcggcctcggcgaccccggccgcacccggatccgc
cccttgggcgcgggccggccgcaatcccagcccgatccgcccggtccgatgctgccgcgc
cccgcctggcaggcgccgcccgatcccgtcgcgcccgaggccgcgccccatgcccggcgc
gggcgggcgcatcccaacccgctggtcgccgcccatgccacgctgctggaactggcgccc
gagcttgagcgcgccaatccccccgcccgccccgatgcgctgcgggcgcggctgcaatcg
gtgctggtcgaggggcgcgacgcctcggtcgccgccggcacgccgctgagccgggccgac
cagggcgcctggttcgtcgccgccctgctggacgacctggcactgaacacgccctggggc
gggcaaagcgactggccccggcagcccttggtgacgcagatgaccggcgaggtcgatgcc
ggcacccgctttttcgaccggctggacacgctgatgcgcaacccggcgggcgagcgcgac
ctgctggaactggcgtggctgtgcctctgcctgggctttcgcggcaagtatcgcgtgcag
ggcggcgccggcgaaggcgcgctggtggcgctgcgcgcgcaaatcgcccggctgctgcgc
gacccggaacgcgaggccgcgccgctggccccgcatggcgccggagtggtcgcgccggat
acgccgcgccgattcgcggtgccgctgtggacgctgtggctgggggcgcttgggctggtc
ctggcgatccatacgggcctctcgatgcatctgtcgggcaaggcggaaagcctgttcacc
caggccgccggcctgccgccgcccgaccgcgccgcgatcttccgcccggtccgccagacc
gtcgagccggccccggaactgccggcaaccgtgatcgacccgctgctgcccgcattcgag
gccgcactgcccgccgccctgcgcccggccatgaaggggcgcgagacctcgggcctcgtg
gtgctggtggtgcgggccagcgaccccgaagtgttccgctcggccaaggccagtctcaac
ccggcctatcagccgctggtcgaggcgatcggcaggaccgtcgtcgccaatgcccatcgc
atcggcgcggtcgcggtcagcggccataccgacaacgtgccggtgcagcgcagcaatccc
ttcgcctcgaaccaggggctgtccgaggcgcgggccgaaaccgtcgcgcaggcgctggcg
gcggccggcgtgcccgccgaactcatcagcgccgagggccgcgccgacagccagccggtg
ggcgacaacgccacccgcgatggccgcgctcagaaccgccggatcgagatccgcatcgag
aagaggcaatag

DBGET integrated database retrieval system