KEGG   Paracoccus denitrificans: Pden_3053Help
Entry
Pden_3053         CDS       T00440                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pde  Paracoccus denitrificans
Pathway
pde00330  Arginine and proline metabolism
pde00360  Phenylalanine metabolism
pde00380  Tryptophan metabolism
pde00627  Aminobenzoate degradation
pde00643  Styrene degradation
pde01100  Metabolic pathways
pde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Pden_3053
   00360 Phenylalanine metabolism
    Pden_3053
   00380 Tryptophan metabolism
    Pden_3053
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Pden_3053
   00643 Styrene degradation
    Pden_3053
Enzymes [BR:pde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Pden_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase VbhA
Motif
Other DBs
NCBI-ProteinID: ABL71134
UniProt: A1B6J0
Position
2:232485..233912
Genome map
AA seq 475 aa AA seqDB search
MISDILDLDATAQAAAVAKGDVSAAELARAAIARIEAGEPVLNAVTQRFFDQALDMASAD
LPPGPFRGVPFLVKDFYCHMAGTPTTGSAKLLEHNLIDHDSALMARYRQAGFVTLGKTNV
PEMVTMGTTEPVWRGPTRNPWNTGHTPGGSSGGSAAAVAAGYVAVAHANDGAGSIRIPAS
CCGLFGLKPSRARVTLGPDVGEAIGGITAEHVVSRSVRDSAAVLDATAGALPGDPYIAPE
PPEGFLAAIARPRKGLRIGLTLDAPDGTSAAPECQAAALRAAVLLRDLGHQVEEVTLPFD
GAAFRAALSTFWPMTVTRGLSAIAEARDADPEVLLRELEPFNQHLFALGISRRAVDYIRD
LVIFQGMARAMGQFFATQDIWLSPVLPFTPPRLGYFDAGVLGGETAWNRVLDSFMFTAPA
NVTGLPSASLPMTVSNEGLPIGIQLTAKLNDEALIFNLAAQLEAANPWAMPRHKI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtgacattcttgatctcgatgcgacagcgcaggctgcggccgtcgcgaagggc
gatgtcagcgcggcagagctggcccgcgccgcgattgcgaggatcgaggccggggagccc
gtgctcaatgcggtgacgcagcgctttttcgatcaggcgctcgatatggcatcagccgat
ctgccgccggggccgtttcgcggcgtgccctttctggtgaaggacttttactgccatatg
gcgggaaccccgaccaccggcagcgcaaagctgctggagcacaacttgatcgaccatgac
agcgcactgatggctcgctatcgccaggcggggtttgtgacgctcggcaagaccaatgtg
ccggaaatggtcaccatgggcacgaccgagccggtctggcgcggccccacgcgtaacccc
tggaataccggtcatacgccgggcgggtcttcgggtggctcggcggcggcggtcgcggcg
ggatatgtcgcggtggcccatgccaatgatggcgccggatccatccgcatcccggcctca
tgctgcggtctcttcgggctgaagccttcgcgggcccgggtcacgctcgggccggatgtt
ggcgaggccatcggtggcatcacggcggaacatgtggtttcgcgatccgtgcgggacagt
gcggcggtgctcgacgccaccgccggagccctgccgggagacccctatatcgcccccgag
ccgccggaaggcttccttgccgccatcgccagaccgcgcaaggggctgcggatcggcctg
acgctcgatgcgccggacggcaccagcgccgcgccggaatgtcaagctgcggctctgcgg
gcggcggtgctcttgcgtgatcttggtcatcaggtcgaggaggtcacgttgcccttcgac
ggcgccgccttccgcgcggcgctctccaccttctggccgatgaccgtgacccggggcctc
agcgcgattgcggaggcccgggacgcggaccccgaagttctgttgcgcgagcttgagccc
tttaaccagcatctcttcgctcttgggatctcgcgccgggcggtagattacatccgggat
cttgtgatctttcagggaatggcgcgggccatggggcagttctttgccacacaggatatc
tggctttcgccggtcctgcccttcacgccgccccggcttggctattttgatgcgggtgtc
ctgggcggggaaacggcctggaaccgggtgctcgactccttcatgttcactgcgcccgcc
aatgtcaccggcctgccttctgccagcttgccgatgaccgtgtcgaatgaggggcttccc
ataggcatccagttgacggcgaagctgaatgacgaagcgctcatcttcaacctcgcagcg
cagcttgaagccgcaaacccctgggcgatgcctaggcacaagatctaa

DBGET integrated database retrieval system