KEGG   Paracoccus denitrificans: Pden_3203Help
Entry
Pden_3203         CDS       T00440                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
pde  Paracoccus denitrificans
Pathway
pde02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pde00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Pden_3203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pde02044]
    Pden_3203
Secretion system [BR:pde02044]
 Type IV secretion system
  Trb secretion system protein
   Pden_3203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI
Motif
Other DBs
NCBI-ProteinID: ABL71284
UniProt: A1B6Z0
Position
2:367428..368594
Genome map
AA seq 388 aa AA seqDB search
MSDRDTAAAPLRLRAEPPRVTRLSRKVLAGLGGIAALGIGAALIFALQTRDVERGGEELF
STENRATADGLAELPRDYAGPVLGPALPGDLGKPILNARNRGEPVPAPGTPTVTAPAMDA
AEQQRLAEEEAARLSGVFFQGGPRSAGGSDMGAGPAGQTPGALGTMGQPGAAATQDRHAA
FLGGAADRITVAPDRVEAPASPYLLQAGSVIPAALITGIRSDLPGQIIAQVTQPVYDSPT
GSILLIPQGTRVIGEYDASVTFGQRRVLLVWNRLIFPDGRSLVLERLPGADASGYAGLED
GVDYHWGELIKAAGLSTLLAVGTELTAGDDDDRLVRAIRDGAQDTVDQAGQQIVQRQLLV
APTLTIRPGFPVRILVGRDLVFENAGER
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagggacaccgccgccgcgccgctgcgcctgcgggcagagccgccccgtgtc
acccggttgtcgcgcaaggtgctggcgggcctcggtgggatcgccgcactcggcatcggg
gcggcgctgatctttgccctgcaaacccgcgacgtcgagcgcggcggcgaggaactgttc
tccaccgaaaaccgcgccaccgccgacgggctggcggaactgccgcgcgactatgccggt
cccgtcctcggcccggcgctgcccggggatctcggcaagccgatcctcaatgcgcgcaat
cgtggtgagccggtgcccgcgcccggcacgcccaccgtcaccgcacccgccatggatgcg
gcggagcagcagcggctggcggaagaagaggcggcaaggctcagcggcgtgttctttcag
ggtgggccacggtctgcgggcgggtcggacatgggcgcagggccagccggtcagacccca
ggcgcgcttggcaccatgggacagcccggcgccgcagccacgcaggaccggcatgcggcg
ttcctgggcggcgccgcagatcgcatcaccgttgccccggatcgtgtcgaagctcctgcc
tcaccctatctgctgcaggccggatcggtgatcccggcggcgctgatcaccggcatccgc
tccgatctgcccggccagatcatcgcccaggtgacgcagccggtctacgacagccctacc
ggctcgatcctgctgatcccgcagggcacccgcgtcatcggcgaatacgatgccagtgtc
acattcggccagcgccgggtgctgctcgtctggaacaggctgatctttcccgatggccgc
tcgctggtgctggagcgcctgccgggcgccgatgccagcggctatgccgggctcgaggac
ggggtcgattaccattggggagagctgataaaggcggccgggctgtcgacgctgctggcg
gtcggcaccgaactcaccgccggtgacgacgacgaccggctggtccgcgccatccgcgac
ggcgcccaggataccgtcgaccaggccggccagcagatcgtccagcgccagctgctggtc
gcccccacgctgaccatccggcccggattcccggtcaggattcttgtcggcagagacttg
gtcttcgagaacgcaggagaaagatga

DBGET integrated database retrieval system