KEGG   Paracoccus denitrificans: Pden_3211Help
Entry
Pden_3211         CDS       T00440                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pde  Paracoccus denitrificans
Pathway
pde00010  Glycolysis / Gluconeogenesis
pde00053  Ascorbate and aldarate metabolism
pde00071  Fatty acid degradation
pde00280  Valine, leucine and isoleucine degradation
pde00310  Lysine degradation
pde00330  Arginine and proline metabolism
pde00340  Histidine metabolism
pde00380  Tryptophan metabolism
pde00410  beta-Alanine metabolism
pde00561  Glycerolipid metabolism
pde00620  Pyruvate metabolism
pde00625  Chloroalkane and chloroalkene degradation
pde00903  Limonene and pinene degradation
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pden_3211
   00053 Ascorbate and aldarate metabolism
    Pden_3211
   00620 Pyruvate metabolism
    Pden_3211
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pden_3211
   00561 Glycerolipid metabolism
    Pden_3211
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pden_3211
   00310 Lysine degradation
    Pden_3211
   00330 Arginine and proline metabolism
    Pden_3211
   00340 Histidine metabolism
    Pden_3211
   00380 Tryptophan metabolism
    Pden_3211
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pden_3211
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pden_3211
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pden_3211
Enzymes [BR:pde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Pden_3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABL71292
UniProt: A1B6Z8
Position
2:375275..376708
Genome map
AA seq 477 aa AA seqDB search
MTAEEAEVKKTHNFVGGKWIPAQATGEIEVINPTTEEVFAVVPEGTAGDVAPAVEAAATA
FPGWSETTIEQRADMLRKFARLTEARAEELTFTGVSEVGQPAAAARVFQTQGAVGELDLM
AEILPEMDWNIPEGKAVVRRVAGGVVGAITAWNGPLRSVISKAGAAMAAGCTVVVKPSEV
APMTAYIFAEICEEAGLPPGVFNLVSGTGPVVGEAIVAHPAVDIVSLTGSVRAGRRVMEV
AAQDIKRVHLELGGKSANILFEDADIDHAISVGIEDAFRNAGQVCGGLTRILVPRTLLAK
VEEAAKAKAESFVIGDPFDPATTLGPVATAAARERIRGYINLGQRQGARMITGGAEPPMG
LNRGFFVKPTVFSGDNSMRIAQEEIFGPVVVIIPFDGEDDAVRIANDSAYGLAGGLWCRD
VERARAIARRIRTGRVRINGTPLEKRAPHGGFKHSGIGREWGRYGIEEFLEYQSIIG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagaggaggccgaagtgaaaaagacccataattttgtgggcgggaaatggatc
cctgcccaggcaactggcgaaatcgaagtgatcaacccgacgacggaagaggttttcgct
gtcgttcccgaggggacagcaggggatgtggcgcctgcggtcgaggccgccgctaccgcc
tttcctggctggtcggaaaccacgatcgagcaacgcgccgacatgctgcgcaagtttgcg
aggctgacggaggcacgggccgaagagctgaccttcaccggcgttagcgaagtcggccag
cctgcggccgccgcacgcgtcttccagacgcagggtgccgtgggagagcttgacctgatg
gccgagatcctgcccgagatggactggaatattcccgagggcaaggcggtggtgcgccgg
gtggcgggtggcgtcgtgggcgccatcactgcatggaatgggccgctgcggtcggtgatc
tcgaaggccggggccgcgatggcggccggatgcacggtcgtggtcaagccaagcgaggtg
gctcctatgaccgcctatatcttcgccgagatttgcgaggaggccggcttgccgccaggt
gtcttcaatttggtctcggggacaggtccggtcgtgggcgaggccatcgtcgcgcatccg
gcggtggatatcgtttcgctgaccggttcagttcgagccgggcgccgggtgatggaggtg
gcggcgcaggacatcaagcgtgtccatctggaactgggtggcaaatccgcgaacatcctt
ttcgaggatgccgatatcgaccacgcgatttcagtcggaatcgaggatgcgttccgcaat
gctgggcaggtctgcggcgggctgacgcgcattctggtgccccggacgctacttgcaaag
gtagaggaagcggccaaggccaaggcagaatccttcgtcatcggcgatccctttgacccg
gccaccacactgggcccggtcgcgaccgcggcggcgcgcgaacgtatccgcggctatatc
aatctgggtcagcggcaaggcgcgcggatgatcaccggcggcgccgagccgcccatgggc
ctgaatcgcggcttcttcgtcaagcccaccgtcttttccggcgataattccatgcgtatc
gcgcaagaggaaatcttcggtccggtcgtggtcatcatccccttcgacggcgaggatgat
gcggtcaggatcgccaatgactcggcctatggcctggccggcggtttgtggtgcagggat
gtggaacgcgcgcgcgcgattgcccgccgcatccggaccgggcgcgtccgcatcaacggc
acgccgctcgagaagcgggcgccccatggtggtttcaagcattccggcatcggtcgcgaa
tggggccgctacgggatcgaggaatttctcgaataccagtcaatcattggctga

DBGET integrated database retrieval system