KEGG   Paracoccus denitrificans: Pden_3713Help
Entry
Pden_3713         CDS       T00440                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pde  Paracoccus denitrificans
Pathway
pde00860  Porphyrin and chlorophyll metabolism
pde01100  Metabolic pathways
Module
pde_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pden_3713
Enzymes [BR:pde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Pden_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA
Motif
Other DBs
NCBI-ProteinID: ABL71780
UniProt: A1B8D6
Position
2:861405..862838
Genome map
AA seq 477 aa AA seqDB search
MGALMIQGTGSNVGKSLLVAGLCRAARRRGIDVAPFKPQNMSNNAAVTPDGGEIGRAQAL
QARAAGLAPSVHMNPVLLKPETDRAAQVVVQGRAATRAAAADYGALKARLMGAVLDSFAR
LRTTHELVLVEGAGSPAEVNLRARDIANMGFARAADVPVVLAGDIDRGGVIAQIVGTQAV
IDPADAAMIRGFVINRFRGDPSLFDAGRRFIVERTGWPDLGLVPWFPDAVRLPAEDAVDL
RRASGGGGLHIACPMLSRIANFDDLDPLAAEPAVRLSMVPPGHALPGDADLVILPGTKST
RGDLAFLREQGWDIDLAAHLRRGGRVLGICGGYQMLGRMIHDPEGHDGSPGSTPGLGLLD
IETRMAPEKRLTRIAGRALGQPVEGYEIHMGRSEGPDCARPFAHIPEPDGATSPDGRVAG
TYLHGLFSGDGFRAAWLGQFGAASALDYGAGVDEVLDRLAGHLEAHLDIDRLFALAR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgctgatgatccaggggacggggtcgaatgtggggaaatccctgctggtggcg
gggctttgccgggctgcaaggcggcgcgggatcgacgtcgcgcccttcaagccgcagaac
atgtcgaacaatgccgccgtgacccccgacgggggagagatcggtcgggcgcaggcgctg
caggcgcgggcggcggggctggcgccttcggtccacatgaacccggtgctgctgaagccc
gagaccgaccgcgccgcccaggtggtggtgcagggccgtgccgcgacgcgggcggcggcg
gcggattacggggcgctcaaggcgcggctgatgggagcggtactggacagcttcgcgcgg
ctgcggacgacgcatgagctggtgctggtcgagggcgcaggctcgccggccgaggtcaac
ctgcgcgcccgcgacatcgccaacatgggcttcgcccgcgctgccgacgtgccggtggtt
ctggccggcgacatcgaccgcgggggcgtgatcgcgcagatcgtcggcacccaggcggtg
atcgacccggctgacgcggcgatgatccgcggcttcgtcatcaaccgctttcgcggcgat
ccctcgctgttcgatgccggccgccgcttcatcgtcgaacgcaccggctggcccgacctg
gggctggtgccgtggttccccgatgccgtgcggctgccggccgaggatgcggtagatctg
cgccgtgcctcggggggcggaggcctgcacatcgcctgcccgatgctgtcgcggatcgcc
aatttcgacgatctcgacccgctcgcggccgagccggcggtgcggttgagcatggtgccg
ccgggccatgccctgccgggcgatgccgatctggtcatcctgccgggcacgaaatccacc
cggggcgacctggcctttctgcgcgaacagggctgggatatcgacctggccgcgcatctg
cggcgcggtgggcgggtgctgggtatctgcggcggctatcagatgctgggtcggatgatc
cacgatcccgagggccatgacggcagccccggcagcacgcccggcctgggcctgctggat
atcgagacccgcatggcgcccgaaaagcggctgacgcggatcgcggggcgcgcgctcggc
cagcccgtcgagggctacgagattcacatgggccgcagcgaaggcccggattgcgcccgt
ccctttgcccatatccccgagccggacggtgccaccagccccgacggacgcgtcgccggc
acctatctgcatgggctcttctcgggcgatggctttcgcgccgcctggcttgggcagttc
ggcgctgcctcggcgctggattacggcgccggcgtcgatgaggtgctcgaccggctggcc
gggcaccttgaggcgcatctggacatcgaccggcttttcgcgctggcgcgctag

DBGET integrated database retrieval system