KEGG   Paracoccus denitrificans: Pden_3894Help
Entry
Pden_3894         CDS       T00440                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pde  Paracoccus denitrificans
Pathway
pde00300  Lysine biosynthesis
pde01100  Metabolic pathways
pde01120  Microbial metabolism in diverse environments
pde01230  Biosynthesis of amino acids
Module
pde_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pden_3894
Enzymes [BR:pde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pden_3894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 DUF1319 ER
Motif
Other DBs
NCBI-ProteinID: ABL71960
UniProt: A1B8W6
Position
2:complement(1028190..1029491)
Genome map
AA seq 433 aa AA seqDB search
MDALALEIENRRDDLIRLTQDLIRIPTLNPPGRNYREICEYLQARLAPRGWTCELIRAHG
APGDSEAFPRWNLVARHRGGPRGECVHFNSHHDVVEVGHGWSRDPFAAELDDGRIYGRGA
CDMKGGLAASIIAAEAFTALYPDHPGQIEISATADEESGGFGGVAYLAGQGAFAHVGHVI
IPEPLHKDRICLGHRGVWWAEIETHGRIAHGSMPFLGDSAIRHMGAVLEEMERTLFPLLM
TKRTQMPVIPEGARNSTLNINSIHGGEPDLGPDFTGLPAPCVADRCRIIIDRRFLIEEEL
SEVKREVAALLEKVKAQRPGFTYEIRDLFEVIPSMTDREAPVVRSTAAAIERVLGREAGY
VVSPGTYDQKHIDRIGKLKNCIAYGPGVLDLAHQPDEWVGVQDMQDSARVMALVLDDILH
GASGDSPGRPPVA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcttgccctcgaaatcgaaaaccgccgcgacgatctgatccgcctgacgcag
gatctgatccgcattccgacgctgaacccgccgggccgcaactatcgcgagatctgcgaa
tatcttcaggcacggctggcgccccggggctggacctgcgaactgatccgcgcccacggt
gccccgggcgacagcgaggcctttccgcgctggaacctggtcgcccgccatcggggcggc
ccgcgcggcgaatgcgtgcatttcaacagccatcacgacgtggtcgaggtcggccatggc
tggagccgcgatccctttgccgcggaactggacgacgggcggatctatggccgcggcgcc
tgcgacatgaagggcgggctggccgccagcatcatcgccgccgaagcctttaccgcgctt
taccccgaccatccgggccagatcgagatcagcgccacggcggacgaggaatcgggcggc
ttcggcggcgtggcctatctggcaggccagggcgcctttgcccatgtcggccatgtcatc
atccccgagcccctgcacaaggaccgcatctgcctgggccatcgcggtgtatggtgggcc
gagatcgagacgcacggccgcatcgcccatggctcgatgcccttcctgggcgacagcgcc
atccgccacatgggcgcggtgctggaagagatggagcgcacgctgttcccgctgctcatg
accaaacggacccagatgccggtgatccccgaaggcgcgcgcaattcgacgctgaacatc
aactcgatccatggcggcgagccggatctcggcccggatttcaccggcctgccagcgccc
tgcgtcgccgaccgctgccgcatcatcatcgaccgccgcttcctgatcgaagaggaactg
tcggaagtaaagcgcgaggtcgccgcgctcctggaaaaggtcaaggcgcaaaggcccggt
ttcacctatgaaatccgcgacctgttcgaggtgatccccagcatgaccgaccgcgaggcg
ccggtggtgcgctcgaccgccgccgccatcgagcgggtgctgggccgcgaggctggctat
gtggtcagccccggcacctatgaccagaagcatatcgaccgcatcggcaagctgaagaac
tgcatcgcctacgggccgggcgtgctggacctggcgcatcagcccgacgaatgggtcggc
gtgcaggatatgcaggattccgctcgtgtcatggccctggtgctcgacgacatcctgcac
ggcgcatcgggggattcccccggccggccgcctgtggcatga

DBGET integrated database retrieval system