KEGG   Paracoccus denitrificans: Pden_3973Help
Entry
Pden_3973         CDS       T00440                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pde  Paracoccus denitrificans
Pathway
pde00471  D-Glutamine and D-glutamate metabolism
pde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Pden_3973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pde01011]
    Pden_3973
Enzymes [BR:pde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Pden_3973
Peptidoglycan biosynthesis and degradation proteins [BR:pde01011]
 Precursor biosynthesis
  Racemase
   Pden_3973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABL72039
UniProt: A1B945
Position
2:1112959..1113771
Genome map
AA seq 270 aa AA seqDB search
MAVGVFDSGLGGLTVLSAIAARMPDLPLVYLGDNAHTPYGVRDADDIFDLTCAGVERLWA
EGCDLVILACNTASAAALKRMQETWLPKDKRVLGVFVPMIEALTERRWGDNSPPREVAVK
HVALFATPATVASRAFQRELAFRAIGVDVEAQPCGGVVDAIEMGDEILAEALVTSHVEAL
LRRMPHPEAAILGCTHYPLVQAAFQKALGPQVTVYSQPNLVAESLEDYLGRHPEMLGAGN
VSRFLTTGDPERVSGKATQFLRHPIRFESA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgggcgtattcgattcgggtctgggcggactgacggttctgtctgcgatcgcc
gcgcgcatgcccgacctgcccctggtctatctgggcgacaatgcccataccccctacggc
gtgcgcgacgccgacgacatcttcgatctgacctgcgccggggtcgagcggctttgggcc
gagggttgcgatctggtgatcctggcctgcaacaccgcctcggccgccgcgctcaagcgc
atgcaggaaacctggctgcccaaggacaagcgcgttctgggggtcttcgtgccaatgatc
gaggcgctgaccgaacggcgctggggcgacaattcgccgccgcgcgaggtggcagtaaag
catgtggcgctgttcgccacgcccgcgaccgtcgccagccgcgccttccagcgggaactg
gcctttcgcgccatcggcgtcgatgtcgaggcccagccttgcggcggcgtcgtcgatgcc
atcgagatgggcgacgagatcctggccgaggcgctggtgacatcccatgtcgaggcgctg
ctgcgccgcatgccgcatcccgaagcggcgatcctgggctgcacccattacccgctggtg
caggccgccttccagaaggcgctggggccgcaggtcacggtctattcccagcccaacctc
gtggcggaaagccttgaggactatcttgggcgccatcccgaaatgctgggcgcgggcaat
gtctcgcgcttcctgaccaccggcgatcctgagcgggtctcgggcaaggccactcaattc
ctccgccatccgatcaggttcgaaagcgcctga

DBGET integrated database retrieval system