KEGG   Paracoccus denitrificans: Pden_4315Help
Entry
Pden_4315         CDS       T00440                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pde  Paracoccus denitrificans
Pathway
pde00260  Glycine, serine and threonine metabolism
pde00750  Vitamin B6 metabolism
pde01100  Metabolic pathways
pde01110  Biosynthesis of secondary metabolites
pde01120  Microbial metabolism in diverse environments
pde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pden_4315
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pden_4315
Enzymes [BR:pde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pden_4315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Baculo_helicase
Motif
Other DBs
NCBI-ProteinID: ABL72379
UniProt: A1BA35
Position
2:complement(1494569..1495957)
Genome map
AA seq 462 aa AA seqDB search
MRYVSTRGRAPVLDFEQAMMTGLARDGGLYLPEAIPMFSADEIARFEGLPYEEVARRVIS
PFVGESFDDAELRDAIARAYQGFDHIARAPLVQLAPGHHLLELFHGPTLAFKDFAMQLIG
QLFQLALARSGQRVTILGATSGDTGSAAIEAFRGLSNVDVFIMYPHGRVSEVQRRQMSTP
ADANVHALAVDGTFDDCQARLKDLFNDHDFRDAVGLAGVNSINWARVLAQIVYYFTAAVS
LGAPRREVDFTVPTGNFGDIFAGSIARTMGLSIGKLIVATNQNDILHRALTSGEYRVGTA
RPSISPSMDIQVSSNFERALWLAYDHDGNAVSRLMDELKSGGFAISQGALQQLRETYVSG
RASEAETTAMIATIREETGEVICPHTAVAVKVAREHMRPGVPMVSLSTAHPAKFPDAVEA
AIGIRPPLPPHMADLFQRDERITRIANDADAIKSLILERRTV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgtttcgacacgggggcgggctccggtcctggacttcgaacaggcgatgatg
accgggctggcgcgggatggcgggctttacctgcccgaggcgatcccgatgttctcggcc
gatgagatcgcccgcttcgagggcctgccctatgaagaggtcgcgcggcgcgtcatcagc
cccttcgtcggcgaaagcttcgacgatgccgagttgcgcgatgccatcgcccgggcctat
cagggcttcgaccatatcgcccgtgcgccgctggtccagcttgcgcccggccatcacctg
ctggagctgttccacgggcccacgctggccttcaaggacttcgccatgcagctgatcggc
cagctgttccagctggcgctggcgcgctcggggcagcgggtcacgatccttggcgcgacc
tcgggcgataccggctcggccgcgatcgaggcgttccggggcctgtccaatgtcgacgtg
ttcatcatgtatccgcatggccgcgtcagcgaggtgcagcgccggcagatgtccacgcct
gccgacgccaacgtccatgcgctggcggtcgacggcaccttcgacgattgccaggcgcgg
ctgaaggatctgttcaacgaccacgatttccgcgatgcggtcgggcttgcgggcgtcaat
tcgatcaactgggcgcgggtgctggcgcagatcgtctattacttcaccgccgccgtcagc
cttggcgcgccgcggcgcgaggtggacttcaccgtgccgaccggcaatttcggcgatatc
ttcgccggctccatcgccaggacgatgggcctgtccatcggcaagctgatcgtggccacc
aaccagaacgacatcctgcaccgggcgctgaccagcggcgaataccgcgtcggcaccgcc
cgtccctcgatcagcccttcgatggacatccaggtcagttcgaacttcgaacgcgcgctg
tggctggcctatgaccatgacggcaatgccgtgtcgcggctgatggacgagctgaaatcc
ggcggcttcgccatcagccagggcgcgttgcagcagttgcgcgagacctatgtctcgggg
cgcgcctcggaggcggagacgacggcgatgatcgccaccatccgcgaggagacgggcgag
gtgatctgcccgcataccgccgtcgccgtgaaggtggcgcgcgagcatatgcgtcccggc
gtgccgatggtcagcctgtcgaccgcgcatccggcgaaattccccgatgcggtcgaggcc
gccatcggcattcgcccgcctctgccgccgcacatggccgacctgttccagcgcgacgaa
cgcatcacccgtattgcaaatgacgccgatgccattaaatcgctgatccttgaacggaga
acagtgtga

DBGET integrated database retrieval system